KEGG   Enterobacter ludwigii: BH714_19105Help
Entry
BH714_19105       CDS       T04719                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
elg  Enterobacter ludwigii
Pathway
elg00473  D-Alanine metabolism
elg01100  Metabolic pathways
elg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BH714_19105
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BH714_19105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elg01011]
    BH714_19105
Enzymes [BR:elg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BH714_19105
Peptidoglycan biosynthesis and degradation proteins [BR:elg01011]
 Precursor biosynthesis
  Racemase
   BH714_19105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOT45199
LinkDB All DBs
Position
4070044..4071123
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLIETARTLPDADAFGVARL
EEAIRLRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNEEQLAALETAELSEPVTVW
MKLDTGMHRLGVRPEKADAFYQRLCQCKNVRQPVNIVSHFARADEPECGATEQQLDIFNT
FCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVSPLENRPWGPDFGFQPVMSLVSN
LIAVRDHKAGEPVGYGGTWTSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREANIVGR
VAMDMICIDLGPDAQDKPGDDVVMWGEGLPVERIAEITKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgtagtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggctcccgccagtaaactcgttgcagtcgtgaaagcgaacgcttacggacac
ggtcttattgagaccgcgcgaacgctccccgatgccgacgcctttggcgtcgcccgtctt
gaagaagccatccgcctgcgcgcgggtgggatcactcaaccgattttgctgctggaaggc
ttttttgaagcggcagatctgccgaccattgctgaccagcatctgcacaccgcggtacat
aacgaagaacaactcgcggcgctggaaaccgccgagctgagtgagcctgtcaccgtctgg
atgaagctcgataccggcatgcaccgtctgggcgtgcgcccggaaaaggcggacgcgttt
tatcagcgtctgtgtcagtgcaaaaacgtccgtcagccggtgaatatcgtgagccacttt
gcccgtgccgatgaacccgagtgtggcgcgaccgagcagcagctggatatttttaatact
ttctgcgaaggcaagccaggaatgcgctccattgccgcgtctggcggtattttgctgtgg
ccgcagtcgcacttcgactgggcgcgtccaggcattattctatacggcgtctctccgctg
gagaacagaccctgggggccggattttggtttccagccggtgatgtcccttgtgtctaac
ctgattgccgtgcgcgatcacaaagcgggtgagcccgtgggctacggcggaacgtggacc
agcgagcgcgacacacgccttggcgtggtggcgatgggctatggcgatggttatcctcgc
gccgcgccgtccggcacgccggtactggtcaatggccgtgaagcgaacatcgtgggccgc
gtggcgatggacatgatctgtattgacctcgggccagatgcacaggacaaaccgggtgat
gacgtggtgatgtggggtgagggtttacctgttgaacgcatcgctgaaatcacaaaagtg
agtgcttacgaacttatcacgcgcctgacatcaagggttgcgatgaagtacatcgactaa

DBGET integrated database retrieval system