KEGG   Enterobacter ludwigii: BH714_22715Help
Entry
BH714_22715       CDS       T04719                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
elg  Enterobacter ludwigii
Pathway
elg00040  Pentose and glucuronate interconversions
elg00051  Fructose and mannose metabolism
elg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BH714_22715
   00051 Fructose and mannose metabolism
    BH714_22715
Enzymes [BR:elg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BH714_22715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AOT45843
LinkDB All DBs
Position
4820467..4821420
Genome map
AA seq 317 aa AA seqDB search
MKFSSRINSFRSRPELFDAKNKMDTCDLITRMGSVEGLTHIELNYPEHFIGQDKELIKKC
IADNGLQVGGIALRYNKDFIDGEFTNPNPALRSKAIETTLEAAEMCKFLEGNTVTLWFGY
DGYDYPFQQDYFRAYELLVDALRIVTQAHGDMQFSFEYKPYEPRTFSFIGDVSSTLMLID
DVGSDNLGITLDFCHMIMKKENPAFSLFQSARKNRLVGFHLNDGYGHFDDGLMLGSVHLL
QTLEYIYYAKRVGFSGLIYFDTFPSREDPVAECAQNIRMYKALSDFIDRLSIPEIEQMIQ
SQDALKVQGMLLKMIAE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcctcccgaattaattctttccgttcaagacctgaactattcgatgcgaaa
aacaaaatggatacgtgtgatctcattacccgtatgggtagtgtggaaggattaacacat
atcgaacttaactatcctgagcattttattggccaggataaagaactgattaaaaaatgt
attgctgataatggtctgcaggtaggtggtattgcgctgcgctacaataaagactttatt
gatggcgagtttaccaacccgaatcctgcgttgcgcagtaaagccattgagacgacgctg
gaagccgctgagatgtgtaaatttctcgagggcaataccgtcaccttatggtttggatat
gacggctatgattacccgttccagcaagattacttccgcgcgtatgagctgctcgttgat
gccttacgcatcgtgacccaggcacatggggatatgcagttcagctttgaatacaaacct
tatgagccgcgtactttctcctttattggggatgtttcctcaaccttgatgttgattgat
gatgttggcagtgacaatctgggtatcaccctcgatttctgccatatgataatgaagaag
gaaaatccggccttctccctgttccagtcagctcgtaaaaaccgcctcgtcggtttccat
cttaatgacggctacggtcatttcgatgatggcctgatgctgggttccgtacatctcctc
cagactctggaatatatctactacgcgaaacgcgttggttttagtggcctgatttatttc
gataccttcccgagccgcgaagatccggtcgcggagtgcgctcagaatatccgtatgtat
aaagcactgtctgactttattgaccgtctcagcattcctgaaattgagcaaatgatccaa
agccaggacgccctgaaagtacagggtatgttactgaaaatgatcgccgaataa

DBGET integrated database retrieval system