KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0145Help
Entry
ETEC_0145         CDS       T02069                                 

Definition
(GenBank) penicillin-binding protein 1B [includes: penicillin-insensitive transglycosylase; penicillin sensitive transpeptidase]
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETEC_0145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:elh01003]
    ETEC_0145
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elh01011]
    ETEC_0145
Enzymes [BR:elh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ETEC_0145
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETEC_0145
Glycosyltransferases [BR:elh01003]
 Polysaccharide
  Bacterial polysaccharide
   ETEC_0145
Peptidoglycan biosynthesis and degradation proteins [BR:elh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ETEC_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: CBI99646
UniProt: E3PCJ9
LinkDB All DBs
Structure
PDB: 

Position
168048..170582
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RILPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctactgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caactgcctgcggcagtttatggccgaatggtcaatcttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggccaacagcattgagatgattcgccgtccgtttgat
ttcccggacagtaaagaaggacaggtgcgcgcgcgtctgacctttgatggcgatcatctg
gcgacgatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgt
ctgatcaccatgatctcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttcccggatttgctggtggatactttgctggcgacagaagaccgtcatttttacgagcat
gatggaatcagtctctactcaatcggacgtgcggtgctggcaaacctgaccgccggacgc
acggtacagggtgcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgttcttactggcgtaaagcgaacgaagcttacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcaagcttgtattactttggtcgcccggtagaa
gagctaagcctcgaccagcaggcgctgttagtcggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccaaaactggcgctggagcgacgtaatctggtgctgcgtctgctg
caacagcaacagattattgatcaagaactctatgacatgttgagtgcccgtccgctgggg
gttcagccgcgcggtggggtgatctctcctcagccagcctttatgcaactggtgcgtcag
gagctgcaggcaaaactgggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcgattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtcggaggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgacggcc
ttaagccagccgaaaatctatcgtctgaatacctggattgcggatgcgccaattgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaatgatgaccgtcgttatagcgaaagc
ggcagagtgatgctggtggatgcgttgacccgttcgatgaacgtgccgacggtaaatctg
gggatggcgctggggctgcctgcggttacggagacctggattaaactgggcgtaccgaaa
gatcagttgcatccggttccggcaatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcattccagaccatcgccagcggtggtaaccgtgcaccgctttctgcgctg
cgttcggtaatcgcggaagatggcaaagtgctgtatcagagcttcccgcaggcggaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggtggtacaacgc
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgacggcagcacggtgaccatc
acctgggtcggccgtgataacaaccagccgaccaaactgtatggtgccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacgccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtatcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagcgagatgcag
cagcagccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggatcaaggatatg
tttggtagtaattaa

DBGET integrated database retrieval system