KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0537Help
Entry
ETEC_0537         CDS       T02069                                 

Definition
(GenBank) glutaminase 1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00220  Arginine biosynthesis
elh00250  Alanine, aspartate and glutamate metabolism
elh00471  D-Glutamine and D-glutamate metabolism
elh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETEC_0537
   00220 Arginine biosynthesis
    ETEC_0537
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETEC_0537
Enzymes [BR:elh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETEC_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CBJ00041
UniProt: E3PFV0
LinkDB All DBs
Structure
PDB: 

Position
572635..573567
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtaccaggtcaactg
gcggcagtggctatcgtgacctgcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcactggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggcgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccatagcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtatacccgtcagtgctccacgctcctc
aatactattgaactggcaacgcttggcgcgacgctggcggcaggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggagtgatgggaattgccgcgttctca
ccaccgctggacgaagatggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system