KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_1024Help
Entry
ETEC_1024         CDS       T02069                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00061  Fatty acid biosynthesis
elh01100  Metabolic pathways
elh01212  Fatty acid metabolism
Module
elh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETEC_1024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:elh01004]
    ETEC_1024
Enzymes [BR:elh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ETEC_1024
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     ETEC_1024
Lipid biosynthesis proteins [BR:elh01004]
 Fatty acid synthase
  Component type
   ETEC_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CBJ00533
UniProt: E3PIX8
LinkDB All DBs
Structure
PDB: 

Position
complement(1122193..1122711)
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgcggtgaa
ctgtttggcgctaaaggcccgcaattgccagcaccgaacatgctgatgatggaccgtgtg
gtcaaaatgaccgaaacgggtggtaacttcgacaaagggtatgttgaagcagaactggat
atcaatccggatctgtggttcttcggatgccactttattggcgatccggttatgccggga
tgcctgggcctggacgcaatgtggcagctggtagggttctacctcggctggctgggcggc
gaaggtaaaggccgcgcgctgggcgttggcgaagtgaaattcactggtcaggtactgccg
acagcgaaaaaagtgacctaccgtattcactttaaacgcattgttaaccgtcgtctgatt
atgggcctggcggatggcgaagtgctggttgatggtcgtctgatctataccgccagcgac
ctgaaagtcggtctgttccaggatacgtctgccttctga

DBGET integrated database retrieval system