KEGG   Erythrobacter litoralis HTCC2594: ELI_01390Help
Entry
ELI_01390         CDS       T00315                                 

Definition
(GenBank) glutamyl-tRNA(gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00970  Aminoacyl-tRNA biosynthesis
eli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eli00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ELI_01390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eli03029]
    ELI_01390
Enzymes [BR:eli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ELI_01390
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ELI_01390
Mitochondrial biogenesis [BR:eli03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ELI_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABC62370
UniProt: Q2ND71
LinkDB All DBs
Position
312594..314090
Genome map
AA seq 498 aa AA seqDB search
MSTYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGASTEFGAEPNAQVSLVDAAMPGMLPV
PNRECIRQAVRTGMAIEAQINTWSRFDRKNYFYADLPQGYQISQLYHPLVGEGQLLIEAD
EKAGISEDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRCGVALMEIVSRPDMRSPAEA
GAYVRKLRAILRYVGSCDGNMEEGSMRADVNVSVRRPGEEFGTRTETKNVNSVRFVMQVI
EYEANRQVDLIESGGAVEQETRLFDPGTGTTRTMRSKEDAHDYRYFPDPDLLPLELEDSF
LDECRASLPELPDAKRQRYENELGLTPYNARELTAEVETFARFETLLAATAKAIGEDEKK
VATQVANWALSVAPGVIKSLGDEAHVENATAERQAAILKMQDAGEISGGQAKEIFEIVLK
EGGDPATIADEKGLKQVSDTGAIEAAIDEILANNEDKVEQYKCGKDKLFGFFVGQTMKAM
QGKANPAVVNQILKDKLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttaccgcatccagggcgcaaccggcgaatgggaggtcgtgatcggcctcgaa
gtccacgcgcaggtcacttccaatgctaagctgttttcgggcgcgtcgaccgagttcggg
gccgagcctaacgcgcaggtcagcctcgtcgatgccgcgatgccgggcatgctgccagtg
cccaaccgcgagtgcatccgccaggcggtgcgcaccggcatggcgatcgaggcgcagatc
aacacatggtcccggttcgaccgcaagaactacttctatgccgacctgccgcagggctac
cagatcagccagctttaccacccgctggtgggcgaggggcagctgctgatcgaagccgac
gagaaggcgggcatttcggaagacaaggtcatcggaatcgagcgcatccatgtcgagcag
gatgccggcaagctgatgcacgaccagcacccgaccatgtcctatgtcgacctcaaccgc
tgcggcgtggcgctgatggaaatcgtcagccgcccggacatgcgctcgcccgccgaggcg
ggggcctatgtgcgcaagctgcgcgcgatcctgcgctatgtcggctcgtgcgacggcaat
atggaagaaggctcgatgcgcgcagacgtgaatgtttcggtgcgccgcccgggcgaagaa
ttcggtacgcggaccgagaccaagaacgtcaactcggtgcgtttcgtcatgcaagtgatc
gaatacgaagccaaccggcaggtcgacctgattgagagcgggggcgcggtcgaacaggaa
acccgcctgttcgatccgggcaccggcaccacgcggaccatgcgcagcaaggaagacgcg
cacgattatcgctacttccccgatcccgacctgctgccgctggagctggaggacagtttc
ctcgacgaatgccgagcgagcctgcccgaactgcccgatgccaagcgccagcgttatgaa
aacgagctaggcctgacgccctacaatgcgcgcgaactgaccgcggaggtcgagactttc
gcccgcttcgaaacgctgctcgccgccaccgccaaggccatcggcgaggacgagaaaaag
gtcgccacgcaagtcgccaactgggccctgtcggtcgcgccgggcgtgattaagtcgctg
ggtgacgaagcgcatgtcgaaaacgccaccgccgagcgccaagccgccatactcaagatg
caggacgcgggcgagatttcgggcggccaggccaaggaaatcttcgagatcgtcctcaag
gaaggcggcgaccccgccaccatcgccgacgagaagggcctcaagcaggtcagcgacacc
ggcgccatcgaagccgcgatcgacgagatccttgccaacaacgaagacaaggtcgagcaa
tacaagtgcggcaaggacaagctgttcggcttcttcgtcggccagacgatgaaagcgatg
cagggcaaagccaatccggcggtggtgaaccagatcctcaaggacaagctcggctga

DBGET integrated database retrieval system