KEGG   Erythrobacter litoralis HTCC2594: ELI_02650Help
Entry
ELI_02650         CDS       T00315                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ELI_02650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eli02000]
    ELI_02650
Enzymes [BR:eli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ELI_02650
Transporters [BR:eli02000]
 Other Transporters
  Pores ion channels [TC:1]
   ELI_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 DDE_Tnp_IS1 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABC62622
UniProt: Q2NCG9
LinkDB All DBs
Position
complement(568905..569531)
Genome map
AA seq 208 aa AA seqDB search
MADFTFYTVAMSRGQIARWALHEAGADYNTEMMTWETRPKSFRAINPMNKVPALVHHHNG
HDHVITECAAICHYLAETHPGPELAPTFEEKADYLRWLFFAAGPLEQAVVAKSMGWEVPE
DRSGMAGFGSFDLTIDALDSWLTDRQFVCGDRFTMADVYVGSQVDWGLQFGTLPERDSLT
AYRERINARPAKQEANAIDMAAMEPADG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttcactttctataccgtcgccatgagccgcgggcagatcgcgcgctgggcg
ctgcacgaggcgggcgccgactacaataccgagatgatgacgtgggagacccggcccaag
agcttccgtgccatcaatccgatgaacaaggtccccgcgctggtgcatcatcacaacggg
catgaccatgtcatcaccgaatgcgcggcgatctgccactatctggcggagacccacccg
ggaccggaattggccccaaccttcgaggaaaaggccgactatttgcgctggctgttcttc
gccgccgggccgttggaacaggcggtcgtggccaaatcgatgggctgggaagtgcccgaa
gaccgcagcgggatggccgggttcggttctttcgatctcaccatagacgctctcgatagc
tggctcacggaccggcagttcgtctgcggcgacaggttcaccatggcggatgtctatgtc
ggcagccaggtcgactggggcctgcaattcggcaccctgcccgagcgcgactccctgacc
gcctatcgcgagcggatcaatgcgcgccctgccaagcaggaggcaaatgcgatcgacatg
gccgcgatggagccggccgatggctga

DBGET integrated database retrieval system