KEGG   Erythrobacter litoralis HTCC2594: ELI_03100Help
Entry
ELI_03100         CDS       T00315                                 

Definition
(GenBank) AccC, acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00061  Fatty acid biosynthesis
eli00620  Pyruvate metabolism
eli00640  Propanoate metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
eli01212  Fatty acid metabolism
Module
eli_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_03100
   00640 Propanoate metabolism
    ELI_03100
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ELI_03100
Enzymes [BR:eli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ELI_03100
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ELI_03100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABC62712
UniProt: Q2NC79
LinkDB All DBs
Position
complement(650656..652005)
Genome map
AA seq 449 aa AA seqDB search
MGIQRILIANRGEIALRIHRAAHEMGIETVAVHSTADSDAMHVRLADHAVCIGPPPATDS
YLNQAAIISAAEVSGCDAIHPGYGFLSENAKFAEIVEAHDIKWIGPKPEHIRTMGDKVAA
KQTAGELGLPLVPGSEGAVSDYDEARKIAAEIGYPVIIKAASGGGGRGMKVCDSAEKLEG
LMKQAGSEAKAAFGDATVYIEKYLGNPRHIEFQVFGDGNGSAIHLGERDCSLQRRHQKVL
EEAPSPVLDSAERHRMGEICADAMRKMAYRGAGTIEFLWEGGEFYFIEMNTRLQVEHPVT
EAITGVDLVREQIRIADGKPLSVNQEEIAFTGHAIECRINAEDPFTFAPSPGKVSHYHPA
GGMHVRVDSGLYAGYSIPPYYDSMIAKLIVYGRNREGCIMRLRRALEEMVVEGVKTSIPL
HQELLRQDDVLNGDYSIKWLEEWLATREA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggtatccaacgcatccttatcgccaatcgcggcgagatcgcgctgcgcatccaccgc
gcggcgcacgaaatgggcatcgagacggtggcggtgcactccaccgccgatagcgatgcc
atgcatgtgcgactggcggaccatgcggtgtgcatcggccctccgcccgcgaccgacagc
tatctcaaccaggccgcgatcatctccgccgccgaggtttcaggttgcgacgccatccac
ccgggctacggctttctctccgaaaacgccaagttcgcggagatcgtcgaagcgcacgat
atcaagtggatcggccccaagcccgaacacattcgcaccatgggcgacaaggtcgccgcc
aagcagaccgcgggtgagcttggcctgccgcttgtgccgggcagcgagggcgcagtttcg
gactatgacgaagcgcgcaagattgccgccgaaatcggctatccggtaatcattaaggcc
gcctcgggcggcggcggtcgcgggatgaaggtctgcgacagcgcggagaagctcgagggc
ctgatgaagcaggctggtagcgaggccaaggccgctttcggcgatgcgacggtctatatc
gagaaatatctcggcaatccgcgccatatcgagtttcaggtcttcggcgacggcaatggc
agcgcgattcatctgggcgagcgcgactgttcgctgcagcgccgccaccagaaagtcctc
gaggaagcgccctcccccgtgctcgacagcgccgagcggcaccggatgggcgaaatctgc
gccgatgccatgcgcaagatggcctatcgcggcgcgggaacgatcgaattcctgtgggaa
ggcggcgagttctacttcatcgagatgaacacccgcctgcaggtcgagcatcctgtgacc
gaggccatcaccggcgtcgacctggtgcgcgaacagatccgcatcgccgacggcaagccg
ctctcggtcaatcaggaagagatcgccttcaccggccatgcgatcgaatgccgcatcaat
gccgaagacccgttcaccttcgcgccgtcacccggcaaggtcagccattaccacccggcg
ggcggcatgcacgtgcgcgtcgattccgggctttacgccggctattcgatcccgccctat
tacgacagtatgatcgccaagctgatcgtctacggccgcaaccgcgagggctgcatcatg
cgcctgaggagggcgctggaggagatggtggtagaaggcgtcaagacctcgatcccgctg
caccaggaattgctgcggcaggacgacgtcctcaacggcgactacagtatcaagtggctg
gaggagtggctggcgacgcgggaggcttag

DBGET integrated database retrieval system