KEGG   Erythrobacter litoralis HTCC2594: ELI_04125Help
Entry
ELI_04125         CDS       T00315                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:eli00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ELI_04125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eli03400]
    ELI_04125
Enzymes [BR:eli01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ELI_04125
DNA repair and recombination proteins [BR:eli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ELI_04125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABC62917
UniProt: Q2NBM4
LinkDB All DBs
Position
complement(851129..853648)
Genome map
AA seq 839 aa AA seqDB search
MARRNDPLAIYNSKRDFAKTPEPSGKAESSAGGDLFIVQKHDATRLHWDLRLEVDGVLKS
WAVTKGPSPDPDIKRLAVRTEDHPVSYAEFEGTIPKGEYGGGTVMLWDRGSWAPIEGKSA
KDLEKGHLHFILQGGRMQGEWLLIRLKKKPGEKRENWLLRKLQDEHAEEGDVLVERELTS
VLTGRSMAEIAADKKGEYPLAGKKDEAFLAQMEKASARNEAKAKQRKRRKAAPLPKFRQP
QLATLVDDVPAGNGWMHEIKFDGYRALVAAKGNDVRVFTRSGKDWTEKFGPLVGAIAALD
LPASLIDGEIVASDADGNPDFSKLQQVLKRGHGSQSKADRLAFHAFDLVELDGEDLAKLP
NIERKERLEAMLATAEPPIHVADHVIGAGEKLYEAMCAAGQEGIISKKIDAPYRHSRSKG
WVKVKCTRRQEFVIVGWKASRAKGRPFASLLMAQNEDGELVYKGNVGTGFTADELDMLAG
KLKRLERKTPPVAVDAASARQVTWVAPKLVAEIAFAEFTADGKIRHGSYLGLRSDKDADD
VKPEKAAPAPKTAANVKISSRDRVVFPDSGQTKGELADYYEAVAGIMLPFAARRPVSLVR
CPQGRAKKCFFQKHDSGAFGDAVHHVPIMEKDGGTKGYLYVEDARGILQCVQMGTIEFHG
WASRTDDVELPDRMIFDLDPDEGLDFGDVKQAARDIKARLSDIGLVSFAMLSGGKGVHVV
VPLAPGHSWDAHKDFARRFAEALSLAEPQRFTATMSKAKRKGKIFIDWLRNQRGSTAVLP
YSARARRGAPVAVPIGWNELKDMQNAKSFSINDANRLLTRAGSKTLAGWGFADQELPDH
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccggaatgacccgctcgccatatacaattccaagcgcgatttcgcaaaaacg
cccgaaccctccggcaaggcggaaagcagtgcgggcggcgacctcttcatagtccagaag
cacgacgccacgcggctgcactgggacttgcgactggaagtggatggcgtgctgaaaagc
tgggcggtcaccaaggggccctctcccgatccggacatcaagcgcctggccgtgcggacg
gaagaccacccggtgtcctacgccgaattcgaagggaccatcccgaagggcgagtacggc
ggcggcacggtaatgctgtgggaccgtggcagctgggccccaatcgagggcaagagcgcg
aaagacctggagaagggccacctccatttcatcctgcagggcgggcgaatgcagggcgag
tggttgttgataaggctgaagaaaaagccgggagaaaagcgggagaactggctcctgcgc
aaattgcaggacgagcatgccgaagaaggcgacgtgctggtggagcgcgagctgacgagc
gtgctgaccggccgctccatggcggaaatcgccgcggacaagaaaggcgaatacccgctg
gccggcaagaaggacgaggcttttctggcgcaaatggagaaggcctccgcccgcaacgag
gccaaggccaagcagagaaaacgtcgcaaggcagcgcccctgccgaagtttcgccaaccg
cagctcgcgaccctggtcgacgacgtgcccgccggaaacggctggatgcacgagatcaag
ttcgatggataccgcgctcttgtcgctgcgaagggcaatgacgtgcgtgtctttacccgc
agcgggaaggactggacggagaagttcggcccgctggtaggagcgattgccgcgctggac
ttgcccgccagcctgatcgacggcgagatcgtggcgagcgatgccgatggcaatcccgat
ttctccaagctgcagcaggtcctgaagcgtggccacggcagccagtccaaggccgaccgg
ctggccttccacgccttcgacctggtcgagctggatggcgaggatctcgccaagctgccc
aatatcgagcgcaaggagcggcttgaggcaatgctcgccacggccgaaccgccgatccac
gtcgccgaccatgtgatcggcgcgggcgagaagctgtacgaggcgatgtgcgccgccggg
caggaaggcatcatttccaagaaaatcgacgcgccctatcgccattcgcgaagcaagggc
tgggtaaaggtcaaatgcacccggcggcaagaattcgtgatcgtcggctggaaggcgtcc
cgcgccaagggccgcccattcgcatcgctgctgatggcgcagaacgaagacggcgagctg
gtctacaagggcaacgtcggcacgggcttcacggccgacgagctggacatgctggccgga
aaactcaaacggctggagcgcaagacgccgccggtggcggtggacgcagccagcgcacgg
caagtgacatgggtggcgccgaagctggtagccgaaatcgcgttcgccgaattcaccgcg
gacggcaagatccggcacggcagttatctgggcctgcggtcggacaaagacgcggacgat
gtgaagccggaaaaggcggcccccgcccctaaaacggcagctaacgtcaagatctccagc
cgcgaccgcgtggtattccccgatagcgggcagaccaagggcgaacttgcggactattac
gaggccgtcgcgggtatcatgctgcccttcgccgcgcgccgtcccgtcagcctcgtgcgc
tgtccacagggacgggccaagaaatgcttcttccagaaacacgatagcggcgcgttcggc
gacgcggtgcaccacgtgccgatcatggagaaggacggcgggacgaagggttacctctat
gtcgaggatgcgcgcggcatcctgcaatgcgtgcagatgggcacgatcgaattccacggc
tgggcctcgcgcaccgacgatgtggaattgccggaccggatgatcttcgacctcgacccg
gacgaggggctggacttcggcgacgtgaagcaggcggcacgcgatataaaggcgcggctt
tccgatatcggcctcgtcagctttgcgatgctttcgggcgggaagggcgtgcatgtcgtg
gtaccattggcgcccggccattcatgggacgcgcacaaggacttcgctcgccgttttgcc
gaggcgctgtcgctggcagagccgcagcgcttcaccgccacgatgagcaaggccaagcgc
aaaggaaagatcttcatcgactggctgcgcaaccagcgcggcagcaccgcggttctacct
tactccgcacgcgcccgtcgcggcgcacccgtggcggtgccaataggctggaacgaattg
aaggatatgcagaacgccaagtcctttagcattaacgacgccaatcgccttctcacacga
gcgggcagcaagacgctggctggatggggctttgcggatcaagagctgccggatcactga

DBGET integrated database retrieval system