KEGG   Erythrobacter litoralis HTCC2594: ELI_10455Help
Entry
ELI_10455         CDS       T00315                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit f
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eli  Erythrobacter litoralis HTCC2594
Brite
KEGG Orthology (KO) [BR:eli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ELI_10455
Enzymes [BR:eli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ELI_10455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Thi4 K_oxygenase FAD_binding_3 DAO Spermine_synth NAD_binding_8 FMO-like NAD_binding_7 AlaDh_PNT_C Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABC64183
UniProt: Q2N808
LinkDB All DBs
Position
2120694..2122283
Genome map
AA seq 529 aa AA seqDB search
MLDASMKQQLQTYFANLREPIELVATLGEDDKSRQTRELLEEIADLHDLVGARFDGDAAR
TPSFTIQRADDTSRAVTFAGLPMGHEFTSLVLALLWGGGHPPKVEQDVLEQIRALEGPLD
FEMFFSLSCHNCPDVVQALTLMALENPNISATLIEGGTFQDEVDRRDVMAVPATFLNGEP
FFNGKMSLEEVLAKVDSGADDKAAARLDAKEPFEVLIVGGGPAGVAAGIYTARKGFTTGI
AAERFGGQLQDTLGIENLPGTAYTEGPKLANELEKQVGENAIDLMNLAEARKLVPAESKG
GLHKVELANGATLKARSLILATGARWRELGVPGEAEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAKIVEHVTLIEFDSKLRADEVLQAKLASLGNVELIKNAKTTEITGT
NGRMNGLVYEDRASGESHTVELAGVFVQIGLVPNTEWLKDSGIALSEYGEIEIDEEGATN
LPGIFAAGDCTTVPYKQIVVAMGEGSKAGLSAFDYLIRTAPAEEIAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcatcgatgaagcagcagttgcagacctatttcgccaatctgcgcgagccg
atcgagctcgtcgccacgcttggcgaagacgacaagtcgcgccagacgcgcgaactgctg
gaagagatcgccgacctgcacgatctcgtcggcgcgcgcttcgacggtgatgctgcgcgc
acgccgagcttcacgatccagcgcgccgatgacactagccgcgcagtcaccttcgcaggc
ctgccgatgggccacgagttcacctcgctggtgttggcgctgctctggggtggcggtcat
ccgcccaaggtcgagcaggacgtgctggagcagatccgcgcgctcgaaggcccgctcgat
ttcgagatgttcttttccctgagctgccacaactgccccgacgtggtgcaggcattgacg
cttatggcgctggagaatccgaacatttccgccacgctgatcgaaggcggcacctttcag
gacgaagtcgaccgccgcgacgtgatggcggtgcctgcgaccttcctcaatggcgagccg
ttcttcaacggcaagatgagcctggaagaggtgctggccaaggtcgatagcggcgccgac
gacaaggccgcagccagactcgacgcgaaggagcctttcgaggtcctgatcgtcggcggc
ggcccggcgggcgtcgcggccggcatctacaccgcgcgcaagggcttcacgaccggcatc
gccgccgagcggttcggcgggcagttgcaggatacgctcggcatcgagaacctgcccggc
acggcttataccgaaggccccaagctcgccaatgagctcgagaagcaggtcggcgaaaac
gcaatcgacctgatgaatctggccgaagcgcgcaagctggtaccagctgaaagcaagggc
ggcttgcacaaggtcgaactcgccaatggcgcgacgctcaaggctcgcagcctgatcctc
gccaccggtgcacgctggcgcgagctgggcgtcccgggcgaggccgaatatcgcaacaag
ggcgtcgcctattgcccgcactgcgacggtccgctgttcaagggcaagcgtgtcgccgtg
atcggtggcggcaattccggcgtcgaagcggccatcgacctcgccaagatcgtcgagcat
gtcacactgatcgaattcgacagcaaattgcgcgccgacgaggtgttgcaggccaagctc
gccagcctgggcaatgtcgagcttatcaagaacgccaagaccacggaaatcaccggcact
aacggccgcatgaacggtctggtctacgaagaccgcgcaagcggcgagagccacacggtc
gaactggctggcgtcttcgtccagatcggcctcgtgcccaataccgaatggctcaaggac
agcggcatcgcccttagcgagtatggcgagatcgagatcgacgaagaaggcgcgaccaac
ctgcccggcatcttcgccgcgggagactgtaccaccgtcccctacaagcagatcgtcgtc
gccatgggtgaaggatcgaaggccgggctgtcggcgttcgattacctcatccgcaccgca
ccggcggaggagattgccgaggcggcgtga

DBGET integrated database retrieval system