KEGG   Erythrobacter litoralis HTCC2594: ELI_10920Help
Entry
ELI_10920         CDS       T00315                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00361  Chlorocyclohexane and chlorobenzene degradation
eli00625  Chloroalkane and chloroalkene degradation
eli01100  Metabolic pathways
eli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ELI_10920
   00361 Chlorocyclohexane and chlorobenzene degradation
    ELI_10920
Enzymes [BR:eli01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     ELI_10920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase Acid_PPase
Motif
Other DBs
NCBI-ProteinID: ABC64276
UniProt: Q2N7R5
LinkDB All DBs
Position
complement(2210091..2210708)
Genome map
AA seq 205 aa AA seqDB search
MHDAGQIEAVVFDVGRVIVQWDLRHLFAKLIDDPAELDWFCDHVVTERWHFQHDAGRPLS
DMVPERQALFPQYADHLHAYATRFVETVPGRVEGTADLIERLAAQNIPLYGITNFGAEFW
DQFLPTEPVLENMRDIVVSGVERVAKPDPRIFRLAEKRFGHPAEAMLFIDDNPANVESAA
ALGWHTHLFTDAATLQTDLAARGLL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgccggacaaatcgaagccgtcgtcttcgacgtcgggcgggtgatcgtccaa
tgggacctgcgccacctcttcgccaaactgatcgacgatcctgcggagctcgactggttc
tgcgatcatgtcgtgaccgagcgctggcacttccagcatgatgcaggccgtccgctcagc
gatatggtgcccgaacggcaggcgctcttcccccagtatgccgaccacctccacgcctat
gcgacacgcttcgtcgagaccgtgccgggccgggtcgaaggcactgccgacctgatcgag
cggctcgccgcgcagaatatcccgctctacggcatcacgaatttcggggccgagttctgg
gaccagttcctgccgaccgagccggtgctggagaacatgcgcgatatcgtcgtctcgggc
gtcgagcgggtggccaagcccgatccgcgcatcttccggctggcggaaaagcgcttcgga
cacccggcggaggccatgctcttcatcgacgacaatccggccaatgtcgaaagcgccgcc
gcgctcggctggcacacgcatctgttcaccgatgctgcgaccctgcagacggatctcgcg
gcgcgcgggctgctctaa

DBGET integrated database retrieval system