KEGG   Eubacterium limosum: B2M23_05185
Entry
B2M23_05185       CDS       T06653                                 

Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
elim  Eubacterium limosum
Pathway
elim00300  Lysine biosynthesis
elim01100  Metabolic pathways
elim01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    B2M23_05185
Enzymes [BR:elim01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     B2M23_05185
SSDB
Motif
Pfam: TrkA_N Shikimate_DH AlaDh_PNT_C NAD_binding_7
Other DBs
NCBI-ProteinID: ARD64973
UniProt: A0A317RMA3
LinkDB
Position
1119549..1120334
AA seq 261 aa
MTRLAESDINTISHSLESCDKILKKQTGKGLFELGCYAAGRALDFSRLKVAAVPVTTGIG
IISGFCDTVASILRYLGAKAYVTEKSDVAGMEEACSRRTDILFMADDDAFGAFNVKKGIH
SDNGSATGRSFAAALELAAGICGEPVLVLGAGPVGRAAVQYFLEKKARVFIYDLDIYRAG
RLKEEFPTVIMLDEWQNRTWTRILDATTAGHFIPRAAVNGETVIAAPGMPLGVPPETAGK
CAKVIHNTLELGVAAMLCEVV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacacgtttagcggaatcagatatcaataccatcagccacagcttagagagctgcgat
aaaattctaaaaaaacagacagggaaaggtctttttgagctgggctgctacgcggccggc
agagcgctggatttctccagactgaaggtggcggctgttcccgtgaccacgggaatcgga
attatcagcggattctgtgacaccgtggcgagcattctccgctatctcggcgcaaaggcc
tatgtcacggagaaaagcgatgtggcgggcatggaggaggcctgttccaggaggacggat
attctcttcatggcggacgacgatgcctttggggctttcaatgtaaaaaaaggaatccac
tctgacaacggcagcgccacgggaaggagctttgcggcggcgctggagctcgcggccggc
atctgcggcgagccggtgctggtgctgggcgcagggccggtaggccgcgcggcggtccag
tatttcctggagaaaaaggccagagtcttcatctatgatttggatatttacagagccggg
cggctgaaagaggaatttccgacagtcattatgctggatgaatggcagaatcgcacctgg
acccggattctggacgccaccactgccggccattttattcctcgggctgccgtcaacggc
gaaaccgtcatcgcagctccgggcatgcccctgggcgtgccgccagagaccgccggaaaa
tgcgcaaaggtgatccacaacaccctggagctgggcgtggcggccatgctgtgcgaggtc
gtgtag

DBGET integrated database retrieval system