KEGG   Entomoplasma luminosum: ELUMI_v1c00060Help
Entry
ELUMI_v1c00060    CDS       T05209                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elj  Entomoplasma luminosum
Pathway
elj00010  Glycolysis / Gluconeogenesis
elj00020  Citrate cycle (TCA cycle)
elj00620  Pyruvate metabolism
elj01100  Metabolic pathways
elj01110  Biosynthesis of secondary metabolites
elj01120  Microbial metabolism in diverse environments
elj01130  Biosynthesis of antibiotics
elj01200  Carbon metabolism
Module
elj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELUMI_v1c00060 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ELUMI_v1c00060 (pdhC)
   00620 Pyruvate metabolism
    ELUMI_v1c00060 (pdhC)
Enzymes [BR:elj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ELUMI_v1c00060 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ATZ16735
UniProt: A0A2K8NSA7
LinkDB All DBs
Position
complement(9513..10799)
Genome map
AA seq 428 aa AA seqDB search
MFKVKFADIGEGLTEGKVAEVLVKLGQEVKAGDPLFFVETDKVNSEIPAPVTGKIANILI
KADQDIVVGEVVMEIDDGSSTAEAKPEPTPAASTTAPIEENASVVGATPVSNKLIDRGGS
VNANQNQSNKQILATPLVRKMAKDLGIDLATITGSGSNGKILSHDLKKPSVNQPAQPSVA
PSPQAGPAFVASFNDALTFESKPMNAIRKATVKAMKKSHTENASFTGFKDIDVTNLVATR
NQIKDVAASQGIKLTFLAFIVKAAAQALKAFPNINVRIDEANNAIQFMNNINIGIAVDTP
EGLMVPVIKSADKMSLFQIAHAISDLATKARDKKLTMKEMTEATFTITNFGSVGLTYATP
IINPPEAAIMGVGSMTKQPVYLDGEFKPRDIMPFVATVDHRVIDGADAGRFLMKIEEYLQ
NPVLLLVG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttaaattcgctgatatcggagaaggattaactgaaggaaaagttgctgaa
gtattagtaaaattgggtcaagaagtaaaagctggagatccacttttctttgttgaaact
gataaagttaattcagaaatcccagccccagtgactggaaaaatcgccaatatcttgatc
aaagctgatcaagatattgttgttggagaagttgtgatggaaattgatgatggttcatca
actgctgaagcaaaaccagaaccaacaccagctgcatcaaccacagctccaatcgaagaa
aatgcaagtgtagttggagcaacccctgtttctaacaagctaattgaccgtggaggttca
gttaatgcaaatcaaaatcaaagtaataaacaaattttggccacaccattagtacgtaaa
atggccaaagatttaggcattgatttagcaactattactggatcaggatcaaatggaaaa
attctttcacacgacttgaaaaaaccaagtgttaatcaaccagcacaaccaagcgttgct
ccaagcccacaagctggaccagcttttgttgcatcatttaatgatgcattaacattcgaa
tcaaaaccaatgaatgcgattcgtaaagcaacagttaaagcgatgaaaaaatcacatact
gaaaatgcttcatttacaggatttaaagatattgatgttactaatttagttgctactcgt
aatcaaattaaagatgttgctgctagtcaaggaatcaaattaactttcctagcatttatt
gttaaagcagctgctcaagcattaaaagcattcccaaatattaatgtcagaattgatgaa
gcaaataatgctattcaatttatgaataatattaacatcggaattgctgttgatacacca
gagggattaatggttcctgtgattaaaagcgctgacaaaatgtcattattccaaattgct
catgcaattagtgatttggcaacaaaagcacgtgataaaaaattaacaatgaaagaaatg
acagaagcaactttcacaattactaattttggttcagttggtttaacttatgcaacacca
attattaacccaccagaagctgcaattatgggagttgggtcaatgaccaaacaaccagtt
tatcttgatggagaatttaaaccaagagatattatgccgtttgtagccacagttgatcat
cgtgtgatcgatggagctgatgctggaagattcttaatgaaaattgaagaatacttacaa
aatccagtacttttattagttggatag

DBGET integrated database retrieval system