KEGG   Enhydra lutris kenyoni (northern sea otter): 111138526
Entry
111138526         CDS       T05871                                 

Definition
(RefSeq) protein reprimo
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111138526
SSDB
Motif
Pfam: Tmemb_9 CobS
Other DBs
NCBI-GeneID: 111138526
NCBI-ProteinID: XP_022348608
UniProt: A0A2Y9IJ03
LinkDB
Position
Unknown
AA seq 109 aa
MNPALDNQTDVAGLLLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaacccggcgctggacaaccagaccgatgtggccggcctgctcctggccaacagcagc
gaggcgctggagcgcgccgtgcgctgctgcacccaggcgtcggtggtgaccgacgacggc
ttcgccgagggcggcccggacgagcgcagcctgtacatcatgcgcgtggtgcagatcgcg
gtcatgtgcgtgctctccctgaccgtggtcttcggcatctttttcctcggctgcaacctc
ctcatcaagtccgagggcatgatcaacttcctggtgaaagaccggagaccgtctaaagag
gtggaagcggtggtcgtggggccctactga

DBGET integrated database retrieval system