KEGG   Enhydra lutris kenyoni (northern sea otter): 111138625
Entry
111138625         CDS       T05871                                 

Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111138625
   04218 Cellular senescence
    111138625
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111138625
   05206 MicroRNAs in cancer
    111138625
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111138625
   05225 Hepatocellular carcinoma
    111138625
   05226 Gastric cancer
    111138625
   05214 Glioma
    111138625
   05220 Chronic myeloid leukemia
    111138625
   05218 Melanoma
    111138625
   05219 Bladder cancer
    111138625
   05215 Prostate cancer
    111138625
   05224 Breast cancer
    111138625
   05222 Small cell lung cancer
    111138625
   05223 Non-small cell lung cancer
    111138625
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111138625
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111138625
   05161 Hepatitis B
    111138625
   05160 Hepatitis C
    111138625
   05163 Human cytomegalovirus infection
    111138625
   05167 Kaposi sarcoma-associated herpesvirus infection
    111138625
   05169 Epstein-Barr virus infection
    111138625
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111138625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111138625
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111138625
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 111138625
NCBI-ProteinID: XP_022346364
UniProt: A0A2Y9IGS3
LinkDB
Position
Unknown
AA seq 466 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFPAAAAAAAAAPGAYIQ
ILTTNTSTTSCTSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPAL
GRGGSGGGGGPPAKRRLELGESGHQYLADGLKTPKGKGRAALRSPDSPKTPKSPSEKTRY
DTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNV
QWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYV
TYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHS
PMKTNNQDHNGNIPKPPSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLE
GPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttccccgccgccgccgccgccgccgctgccgccccgggcgcgtacatccag
atcctcaccacgaacacttccaccacctcctgtacctcctccctccaaagcggcgccgtc
gccgccggccccctcctccccagtgcccccggcgcggagcagaccgccggcagcctcctc
tacaccacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcgctg
ggacgcggcggcagcggcggcggcggcggccctccggcaaagcgaaggctggagctagga
gaaagcggtcatcagtacctcgcagatggcttaaaaacccccaagggcaaaggaagagcc
gccctgcgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacacggtat
gacacatcccttggtctgctcaccaagaagttcattcagctgctgagccagtcccccgac
ggggtcttggatttgaacaaggcggcggaggtactgaaggtgcagaagaggagaatctac
gacatcaccaacgtgctagagggcatccacctcatcaagaagaagtcgaagaacaacgtg
cagtggatgggctgcagtctgtctgaagatgggggcatgctggcccagtgtcaaggcctg
tccaaggaagtgaccgagctcagccaggaagagaagaaattagatgaactgatccaaagc
tgcaccctggacctcaaactgctaaccgaagactcagagaaccaaaggttagcttacgtt
acatatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtcaaa
gcccctccagaaacaagacttgaagtgcctgacccaatagagagcctacaaatacatttg
gcaagtacccaagggcccattgaggtttatttgtgtccagaagagacagaaacacacagt
ccaatgaaaacaaacaaccaagaccacaatgggaatatcccgaaacccccttccaaagac
ttggcttcaaccaactcaggacatagcgattgttcgatttctatggcaaacctttctcct
ttggcctccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaa
ggaccatttgtgaacttactgcctcccctgctccaagaagactatctcctaagcctcggg
gaggaagaaggcattagcgatctctttgatgcttatgatttggagaagctcccgcttgtg
gaagacttcatgtgtagttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141556
Entry
111141556         CDS       T05871                                 

Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04137  Mitophagy - animal
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111141556
  09143 Cell growth and death
   04110 Cell cycle
    111141556
   04218 Cellular senescence
    111141556
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141556
   05206 MicroRNAs in cancer
    111141556
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111141556
   05225 Hepatocellular carcinoma
    111141556
   05226 Gastric cancer
    111141556
   05214 Glioma
    111141556
   05220 Chronic myeloid leukemia
    111141556
   05218 Melanoma
    111141556
   05219 Bladder cancer
    111141556
   05215 Prostate cancer
    111141556
   05224 Breast cancer
    111141556
   05222 Small cell lung cancer
    111141556
   05223 Non-small cell lung cancer
    111141556
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111141556
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111141556
   05161 Hepatitis B
    111141556
   05160 Hepatitis C
    111141556
   05163 Human cytomegalovirus infection
    111141556
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141556
   05169 Epstein-Barr virus infection
    111141556
   05165 Human papillomavirus infection
    111141556
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111141556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111141556
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111141556
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 111141556
NCBI-ProteinID: XP_022349891
UniProt: A0A2Y9INW6
LinkDB
Position
Unknown
AA seq 450 aa
MAVAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAAPAAGPRDPDLLL
FATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEK
SRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSK
NHIQWLGSHAAVGIGGRLEGLTQDLRQLQESERQLDHLIHLCTTQLRLLSEDADSQRLAY
VTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESAGG
ISPGKTPSQGTASGEEDRAVDPATTVPPPSSPPSSPAADPSQSLLSLEQEPLLSRMGGLR
APVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGAPRGPGWP
PAPRILRADQARWRGLGLLVCRTARALLSS
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggccgtggcccccgcaggcggcccatgcgcgccggcactggaggccctgctcggggcc
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcaggacgcc
agcgccccgccggcccccgccgcgcccgctgccggcccccgcgaccccgacctgctgctc
ttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgccctgcgctcggccgc
ccgccggtaaagcggaggttggacctggaaacagaccatcagtacctggctgagagcagc
gggccggcccggggcagaggtcgccacccaggaaaaggtgtgaaatccccaggggagaag
tcacgctatgagacctcgctgaatctgaccacgaagcgcttcctggagctgctgagccgc
tcagccgatggcgttgttgatctgaactgggccgccgaggtgctgaaggtgcagaaacgg
cgcatctatgacatcaccaatgtcctcgagggcatccagctcattgccaagaagtccaag
aaccacatccagtggctaggcagccacgcggcagtggggatcggcgggcggctggagggc
ctgacccaagacctgcggcagctccaggagagcgagcggcagctggaccatctgatccat
ctctgcaccacccaactgcggctgctctctgaggacgctgacagccagcgcctggcctac
gtgacctgccaggaccttcgtagtattgcagaccctgcagagcagatggtcatggtgatc
aaggcccctcctgagacccagctccaagccgtagactcctcagagacctttcagatctcc
cttaagagcaaacaaggccccattgatgttttcctgtgccctgaggagagtgcaggcggg
atcagccctgggaagaccccatcccaggggacagcctctggggaggaggacagggcagtt
gaccctgccaccacagtgccaccgccatcatctcccccctcgtcccctgctgcggatccc
agccagtccctgctcagcctggagcaagaacctctgctttcccggatgggcggcctgcgg
gcccctgtggacgaggaccgcctgtccccgctggtggcggccgactctctcctggaacat
gtgcgggaggacttctccggcctcctccctgaggagttcatcagcctgtcccccccccat
gaggccctcgactaccactttggccttgaggagggggccccacgaggcccagggtggcca
cctgcccccagaatcctgcgtgctgaccaggccaggtggcgaggccttggcttgcttgtt
tgcaggacagcaagagcacttctgtcgtcttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154729
Entry
111154729         CDS       T05871                                 

Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111154729
   04218 Cellular senescence
    111154729
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154729
   05206 MicroRNAs in cancer
    111154729
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111154729
   05225 Hepatocellular carcinoma
    111154729
   05226 Gastric cancer
    111154729
   05214 Glioma
    111154729
   05220 Chronic myeloid leukemia
    111154729
   05218 Melanoma
    111154729
   05219 Bladder cancer
    111154729
   05215 Prostate cancer
    111154729
   05224 Breast cancer
    111154729
   05222 Small cell lung cancer
    111154729
   05223 Non-small cell lung cancer
    111154729
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111154729
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154729
   05161 Hepatitis B
    111154729
   05160 Hepatitis C
    111154729
   05163 Human cytomegalovirus infection
    111154729
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154729
   05169 Epstein-Barr virus infection
    111154729
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111154729
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111154729
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    111154729
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 111154729
NCBI-ProteinID: XP_022370308
UniProt: A0A2Y9KB25
LinkDB
Position
Unknown
AA seq 438 aa
MLRGPQALAPAAGPPSKGLHAMSPTELWPPGLSSPQLCPATTTYYTSLYPQTVPPTAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKCLRVDGLPSPRT
PKSPGEKTRYDTSLGLLTKKFIYLLSESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMSAEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPAKEPLPPTSTLGPSPDSAQPGSSTDPGMTEPVASPALTPQQVPQPPA
PPPLPLVPLEATDSLLELPHPLLQQTEDQFLSPSLPCSSPLISFSPPLDQDDYLWGLDGG
EGISDLFDSYDLGDLLIN
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccaggccctggctccagccgccgggccgccctcgaagggactgcac
gcgatgagccctaccgagctgtggccgcccggcctcagcagcccccagctctgcccggcc
accaccacctactacacctcgctgtacccgcagactgtgcctcccactgcggcgcccggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgcccgct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggagaccagcggtccct
gagttccggactcccaaggggaagtgccttagagtggacggtctccccagccccagaacc
cccaagtcccctggagagaagactcgttatgatacgtcgctggggctgctcaccaagaag
ttcatttacctcctgagcgaatccaaggatggggtcctggacctgaactgggctgccgag
gtgctggacgtgcagaaacggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgtaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcccgggaagcagcagcagctggggcaggagctgaaggagctgatgagcgcg
gagcaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgacggag
gacaaggccaacaagagactggcctacgtgacttaccaggacatccgtgctgttggcaac
tttaaggagcagacggtgatcgctgtcaaggcccctccgcagacaagactcgaggtgccc
gacaggagcgaggagaacctgcagatatacctgaagagcacccaggggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagcccgacagtcctgccaaggagcccctcccgcca
acctccacccttggccccagccctgactccgcccagcctggcagcagcacggaccctggg
atgacagaacccgtggcatccccagcgctgactccccagcaagtcccgcagccgcctgcg
cccccgcccctgccgcttgtccccctggaggccaccgacagcctgctggagctgccacac
ccacttctgcagcagactgaggaccagttcctgtccccgagcctgccgtgcagctctccc
ctgatcagcttctccccgcccttggaccaggacgactacctgtggggcctggacgggggt
gagggtatcagtgacctcttcgactcctacgaccttggggacctgctgattaactga

DBGET integrated database retrieval system