KEGG   Enhydra lutris kenyoni (northern sea otter): 111138630
Entry
111138630         CDS       T05871                                 

Definition
(RefSeq) prolactin isoform X1
  KO
K05439  prolactin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111138630
   04151 PI3K-Akt signaling pathway
    111138630
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111138630
   04060 Cytokine-cytokine receptor interaction
    111138630
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111138630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111138630
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111138630
SSDB
Motif
Pfam: Hormone_1 KIAA1430
Other DBs
NCBI-GeneID: 111138630
NCBI-ProteinID: XP_022346368
UniProt: A0A2Y9ICL5
LinkDB
Position
Unknown
AA seq 230 aa
MDDKGWSVKAGSLLPLLLLVSDLLLCQGVASLPICPTGAVNCQVSLRDLFDRAVILSHYI
HNLSSEMFNEFDRRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLR
SWNDPLYHLVTEVRGMEEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSV
WSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
NT seq 693 nt   +upstreamnt  +downstreamnt
atggacgacaaagggtggtcagtgaaagcagggtctctcctgcccctgctgctgctggtg
tcagacctgctcctgtgccagggcgtggcctccctgcccatctgtcccaccggtgctgtc
aactgccaggtgtccctccgagacctgtttgaccgcgcagtcattctttcccactacatc
cataacctctcctcggagatgttcaacgaattcgatagaaggtatgcccagggccggggg
ttcattaccaaggccatcaacagctgtcacacttcctccctctccaccccggaagacaag
gagcaagcccagcagatccaccacgaagaccttctgaacttgatactcagagtgctgcgc
tcctggaacgaccccctgtatcatctagtcacagaagtgcggggcatggaagaagcccca
gattccattctctccagggccattgagattgaggaacaaaacagaagacttctagagggt
atggagaagatagttggccaggttcatcctggagtcagagaaaacgaggtctactctgtc
tggtcaggacttccatctctgcagatggctgatgaagactcgcgcctttttgctttttat
aacctgctccactgcctacgcagggattcacacaagattgacaattatctcaagctcctg
aagtgccgaatcgtctacgatagcaactgctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111145625
Entry
111145625         CDS       T05871                                 

Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111145625
   04066 HIF-1 signaling pathway
    111145625
   04151 PI3K-Akt signaling pathway
    111145625
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111145625
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111145625
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111145625
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111145625
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111145625
NCBI-ProteinID: XP_022356364
UniProt: A0A2Y9J9L7
LinkDB
Position
Unknown
AA seq 192 aa
MGVCECPALLLLLSLLLLPLGLPVLGGPPRLICDSRVLERYILEAREAENVTMGCAQGCS
FSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLALLSEAILRGQALLANASQPSETLQLH
VDKAVSSLRSLTSLLRALGAQKEASSLPEEASAAPLRTFTVDTLCKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgtgcgaatgtcctgccctgttgcttctgctgtctttgctgctgcttcctctg
ggcctcccagtcctgggcggcccccctcgcctcatctgtgacagccgagtcctggagaga
tatatcctggaggcccgggaggcagaaaatgtcacgatgggctgtgctcaaggctgcagc
ttcagtgagaatatcaccgtcccagacaccaaggttaatttctacacctggaagaggatg
gacgtcgggcagcaggccgtggaagtctggcagggcctggctctgctctcggaagccatc
ctgcggggccaggccctgttggccaacgcctcgcagccgtctgagaccctgcagctgcat
gtggacaaagccgtcagtagcctacgcagcctcacctccctgctgcgggcgctgggagcc
cagaaggaggccagctcccttccagaggaagcttctgctgctccactccgaacattcact
gttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggcaagctgacg
ctgtacacaggggaggcctgcaggagaggggacaggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111149426
Entry
111149426         CDS       T05871                                 

Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111149426
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111149426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111149426
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111149426
SSDB
Motif
Pfam: CNTF Neurexophilin
Other DBs
NCBI-GeneID: 111149426
NCBI-ProteinID: XP_022362176
UniProt: A0A2Y9JNI0
LinkDB
Position
Unknown
AA seq 200 aa
MAFAEHSPLTPHRRDLCSRSIWLARKIRSDLTALLESYMKHQGLNENINLDSVDGVPMAS
TDRWSELTEAERLQENLQAYRAFHAMLARLLEDQQVHFTPAEGDFHQAIHTILLQVAAFA
YQLEELMMLLEHKIPPNEADGMPMIGGDGGLFEKKLWGLKVLRELSQWTVRSIHDLRVIS
SHQTGIPTHGSHYIANDKKI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcttttgcagagcactcaccgctgacccctcaccgccgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttttggaatcttatatgaag
catcagggcctgaacgagaacataaacctggactctgtggatggcgtgccaatggcaagc
actgatcggtggagtgagctgactgaggcagagcgactccaagagaacctccaagcttat
cgtgccttccatgctatgttggccaggcttttagaagaccagcaggtgcattttactcca
gctgaaggggatttccatcaagcaatacataccatcctgctccaagttgctgcctttgct
taccagctggaggaattaatgatgctgttggaacacaagattccccccaacgaggctgat
gggatgcccatgattggtggagatggtggtctcttcgagaagaagctgtggggcttaaag
gtgttgcgagagctttcacagtggacagtgagatctatccatgaccttcgagtcatttct
tctcatcagacggggattccaacacatgggagccattatattgctaatgacaagaaaata
tag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151805
Entry
111151805         CDS       T05871                                 

Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151805
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151805
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111151805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151805
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111151805
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111151805
NCBI-ProteinID: XP_022365726
UniProt: A0A2Y9JXZ3
LinkDB
Position
Unknown
AA seq 325 aa
MELTELLLVVMLLLTARLDLCLPAPPACDPRLLNKLLRDSHALHSRLSQCPDVNPLSTPV
LLPAVDFSLGEWKTQKEQTKAQDVLGAAALLLEGVMAARTQLGPTCLSSLLGQLSGQVRL
LLGALQGLLGTQLPPQGRTTTHKDLNAIFLTFQQLLRGKVRFLLLVVGPTLCAKQALPTT
AVPSNTSLFLTLYKLPNRTSGLLETNSSVSARTTGSGLLKRLQGFRAKIPGLLNQTSRSL
DQMPGHLNRTHGPLIGTRGLFPGPLPTALGAPDIPLATSGMDSLPPDLWPGYSPSPAHPP
TGQYTLFSPSPTSPTPPGPAPTSIS
NT seq 978 nt   +upstreamnt  +downstreamnt
atggagctgactgaactgctcctcgtggtcatgcttctcctaactgcaagactggatctg
tgcctcccggctcctcccgcctgtgacccacgtctcctaaataaactgcttcgtgactcc
catgcccttcacagcagactgagccagtgtccagacgttaaccctttgtccacacctgtc
ctgctgcctgctgtggacttcagcttgggagaatggaaaacccagaaggagcagaccaag
gcacaggacgttctgggagccgcagcccttctgctggagggagtgatggcagcacggacc
caactgggacccacctgcctctcatccctcctgggacagctttctggacaggtccgcctc
ctccttggggccctgcagggcctccttggaacccagcttcctccacagggcaggaccaca
actcacaaggatctcaatgccatattcctgaccttccaacaactgctccgaggaaaggtg
cgcttcctgttgcttgtagtagggcccaccctctgtgccaagcaggccctacccacgaca
gctgtcccaagcaatacctctctattcctcacactgtacaagctcccaaacaggacttct
ggactgttggagacaaactccagtgtctccgccagaactactggctctggacttctgaag
aggctgcagggattcagagccaagattcctggtctgctgaaccagacctccaggtcccta
gaccaaatgcctggacacctaaacaggacacacggacccttgattggaactcgtggactc
tttcctggacccttacctacagccctaggagccccagatatccctctggcaacttcaggc
atggactccctgccccccgacctctggcctggatattctccttccccagcccatcctcct
actgggcaatacacactcttttctccttcacccacctcacccacccctccgggaccggct
ccaacctccatctcctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151817
Entry
111151817         CDS       T05871                                 

Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk05144  Malaria
elk05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151817
   04151 PI3K-Akt signaling pathway
    111151817
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151817
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111151817
   04657 IL-17 signaling pathway
    111151817
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111151817
  09174 Infectious disease: parasitic
   05144 Malaria
    111151817
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151817
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111151817
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 111151817
NCBI-ProteinID: XP_022365740
UniProt: A0A2Y9K8B4
LinkDB
Position
Unknown
AA seq 195 aa
MKLTALQLLLWYEALWLVQAAAPLGPTSSLPQSFLLKCLEQMRKVQADSTVLQERLCATH
KLCHPEELVLLGHALGIPQPSLSGCSSQALQLTGCLRQLHSALVLYQGLLQALTGLPPEL
TPALETLQLDIGDFAINLWREMEELGVAPAVPPTQGAMPAFTSAFQRRAGGVLVASNLQS
FLELAYRALRAFAKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgaccgccctgcagctgctactgtggtatgaggcactctggctggttcaagca
gccgcccccctgggccctaccagctccctgccccagagcttcctgctcaagtgcttagag
caaatgaggaaggtgcaggctgacagcaccgtgctgcaggagaggctgtgcgccacccac
aagctgtgccaccccgaggagctggtgcttctcggacacgctttgggcatcccccagcct
tccctgagtggctgctccagccaggccctgcagctgacgggctgcctgcgtcaactccac
agcgccctcgtcctctaccagggcctcctgcaggctctgacagggctaccccctgagctc
acccctgccttggaaacgctgcagctggacatcggcgacttcgccatcaacctctggcgg
gagatggaagagctgggggtggccccggcagtgccacccacccagggtgccatgccagcc
ttcacctcggccttccagcgccgggccggaggggtcctggtggcctccaacctgcagagc
ttcctggagctggcctaccgtgctctgcgcgcctttgccaaaccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151979
Entry
111151979         CDS       T05871                                 

Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04152  AMPK signaling pathway
elk04630  JAK-STAT signaling pathway
elk04920  Adipocytokine signaling pathway
elk04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151979
   04152 AMPK signaling pathway
    111151979
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111151979
   04060 Cytokine-cytokine receptor interaction
    111151979
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111151979
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111151979
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151979
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111151979
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 111151979
NCBI-ProteinID: XP_022365942
UniProt: A0A2Y9JXT1
LinkDB
Position
Unknown
AA seq 167 aa
MRCGPLCRFLWLWPYLSYVEAVPIRKVQDDTKTLIKTIVTRISDISHTQAVSSKQRVAGL
DFIPGLHPVLSLSRMDQTLAIYQQILTSLHSRNVIQISNDLENLRDLLRLLASSKSCPLP
RARGLESFESLGGVLEASLYSTEVVALSRLQTALQDMLGRLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgttgcggacccctgtgccgattcctgtggctttggccctatctgtcctatgttgaa
gctgtgcccatccgaaaagtccaggatgataccaaaaccctcatcaagacgattgtcacc
aggatcagtgacatttcacacacgcaagctgtctcctccaaacagagggtcgctggtcta
gacttcattcctgggctccaccctgtcctgagtctgtccaggatggaccagacattggcc
atctaccaacagatcctcaccagtctgcattccagaaatgtgatccaaatatctaatgac
ctggagaacctccgagaccttctccgcctgttggcctcctccaagagctgccccttgccc
cgggcgaggggcctggagagctttgagagcctgggtggtgtcctagaagcctcactctac
tccacggaggtggtggccctgagcaggctccagacggccctccaggacatgcttgggcgg
ctggacctcagccctgggtgctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158084
Entry
111158084         CDS       T05871                                 

Definition
(RefSeq) somatotropin isoform X1
  KO
K05438  growth hormone
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111158084
   04151 PI3K-Akt signaling pathway
    111158084
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111158084
   04060 Cytokine-cytokine receptor interaction
    111158084
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111158084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111158084
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111158084
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 111158084
NCBI-ProteinID: XP_022375618
UniProt: A0A2Y9KR60
LinkDB
Position
Unknown
AA seq 245 aa
MLSAPGGRGRAGRKWASRRLGPSLALCVPLCAGPRNSVLLVFTLLCLPWPQEVGAFPAMP
LSSLFANAVLRAQHLHQLAADTYKDFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDE
AQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRE
LEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVE
SSCAF
NT seq 738 nt   +upstreamnt  +downstreamnt
atgctctcagcccctggggggaggggaagggctggcaggaaatgggcatctcgtcgtctg
ggccccagccttgccctctgtgtccctctgtgtgcaggtcctcggaactccgtgctcctg
gtcttcaccctgctctgcctgccctggcctcaggaggtgggcgccttcccggccatgccc
ttgtccagcctgtttgctaacgccgtgctccgggcccagcacctgcaccagctggctgct
gacacctacaaagactttgagcgggcgtacatccccgagggccagaggtactccatccag
aacgcgcaggccgccttctgcttctcagagaccatcccggcgcccaccggcaaggacgag
gcccagcagagatccgacgtggagctgctccgcttctcgctgctgctcatccagtcgtgg
ctggggcccgtgcagttcctcagcagggtcttcaccaacagcctggtgttcggcacctcg
gaccgagtctacgagaagctgaaggacctggaggaaggcatccaagcgctgatgcgggag
ctggaagacggcagcccccgggccgggcagatcctgaagcaaacctacgacaagtttgac
acaaacctgcgcagcgacgatgcgctgctcaagaactatgggctgctctcctgcttcaag
aaggacctgcacaaggccgagacctatctgcgggtcatgaagtgtcgccgcttcgtggaa
agcagctgtgccttctag

DBGET integrated database retrieval system