KEGG   Enhydra lutris kenyoni (northern sea otter): 111138866
Entry
111138866         CDS       T05871                                 

Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04510  Focal adhesion
elk04650  Natural killer cell mediated cytotoxicity
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05100  Bacterial invasion of epithelial cells
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05220  Chronic myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111138866
   04014 Ras signaling pathway
    111138866
   04072 Phospholipase D signaling pathway
    111138866
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111138866
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111138866
   04062 Chemokine signaling pathway
    111138866
  09152 Endocrine system
   04910 Insulin signaling pathway
    111138866
   04915 Estrogen signaling pathway
    111138866
   04917 Prolactin signaling pathway
    111138866
   04926 Relaxin signaling pathway
    111138866
   04935 Growth hormone synthesis, secretion and action
    111138866
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111138866
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111138866
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111138866
   05226 Gastric cancer
    111138866
   05214 Glioma
    111138866
   05220 Chronic myeloid leukemia
    111138866
   05224 Breast cancer
    111138866
  09165 Substance dependence
   05034 Alcoholism
    111138866
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111138866
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111138866
   01522 Endocrine resistance
    111138866
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 111138866
NCBI-ProteinID: XP_022346501
UniProt: A0A2Y9IDQ0
LinkDB
Position
Unknown
AA seq 584 aa
MDLLPPKSKYNPLRNESLSSLEEGASGPSPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGPGGVAAPDSGPPPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCDAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLVAADCRQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPGHQYYNDFPGKEPPL
GGVVDMRLREGAPLGAARSPPPVGQTPSHLGATLLVGQPVGADPETRRQMPPPPPCPAGK
ELFDDPSYVNVQNLDKARQAGGGAGPPNAAVNGSTPRDLFDMKPFEDALQVPPPPQAVAM
AEQLRGEAWFHGKLSRREAEALLQLHGDFLVRESASSPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagtccaagtacaaccctctccggaacgagtctctgtcatcg
ctggaggagggggcttcagggccctccccaccggaggagctgccttccccatcagcctca
tctctggggcccatcctgccacctctgcccggggacgacagtcccaccaccctgtgctcc
ttcttcccccgaatgagcaacctgaagctggccaacccagctggggggcgcccggggcca
aagggggagccaggaagggcagctgaggatggggaggggcccggaggggtggctgcgcca
gactcaggccccccgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacgcgccacgggagcttt
gtcaataagcccacacggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacctggttcggtacatgggctgcgtggaggttctgcagtcaatgcgcgccttggac
ttcaacacccgcacccaggtcaccagggaggccatcagcctggtgtgtgatgccgtgccc
ggtgccaagggggcgacgaggaggagaaagccctgtagccgcccgctcagttccatcctg
gggaggagtaacctgaaatttgccgggatgccgatcactctcaccgtctccaccagcagc
ctcaacctcgtggccgcagactgcagacagatcatcgccaaccaccacatgcagtctatc
tcgtttgcgtccggtggagacccggacacagctgagtacgtcgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggagtgtcctgaggggctggctcaggatgtc
atcagcaccatcggccaggccttcgagttgcgcttcaaacagtacctcaggaacccgccc
aagctggtcacccctcatgacaggatggctggttttgatggctcagcttgggatgaggaa
gaggaagagccacctggccaccagtactataatgacttcccgggaaaggaaccccctctt
gggggagtggtggacatgaggcttcgggaaggagccccccttggggcagctcgatccccc
ccacctgttggccagacccccagccacctgggagcaacgctgctggtggggcagcctgtg
ggggcagacccggaaacccgcagacagatgccacctccgccgccctgcccagcagggaaa
gagctctttgacgatccttcttatgtcaacgtgcagaacctggacaaggcccggcaggca
gggggtggggctgggcctcccaatgctgccgtcaatggcagcacgccccgagacctcttt
gacatgaagcccttcgaagatgcccttcaggtgcctccgcccccccaggcggtggccatg
gctgagcagctccgaggggaggcctggttccacgggaagctgagccggcgggaggccgag
gcgctgctgcagctgcacggggacttcctggtgcgggagagcgcgagcagcccgggccag
tacgtgctcactggcctgcagagcgggcagcccaagcacctgctgctggtggacccagag
ggcgtggttcggacaaaggaccaccgctttgagagcgtcagtcacctcatcagctaccat
gtggacaatcacttgcccatcatctctgcgggcagtgaactgtgtctccagcagcccgtg
gagcggaagctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153623
Entry
111153623         CDS       T05871                                 

Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04510  Focal adhesion
elk04650  Natural killer cell mediated cytotoxicity
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05100  Bacterial invasion of epithelial cells
elk05214  Glioma
elk05220  Chronic myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111153623
   04014 Ras signaling pathway
    111153623
   04072 Phospholipase D signaling pathway
    111153623
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111153623
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111153623
   04062 Chemokine signaling pathway
    111153623
  09152 Endocrine system
   04910 Insulin signaling pathway
    111153623
   04915 Estrogen signaling pathway
    111153623
   04917 Prolactin signaling pathway
    111153623
   04926 Relaxin signaling pathway
    111153623
   04935 Growth hormone synthesis, secretion and action
    111153623
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111153623
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111153623
   05226 Gastric cancer
    111153623
   05214 Glioma
    111153623
   05220 Chronic myeloid leukemia
    111153623
   05224 Breast cancer
    111153623
  09165 Substance dependence
   05034 Alcoholism
    111153623
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111153623
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111153623
   01522 Endocrine resistance
    111153623
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 111153623
NCBI-ProteinID: XP_022368474
UniProt: A0A2Y9KA56
LinkDB
Position
Unknown
AA seq 587 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRRAPDDGP
GSLGHLLHKVSHLKLSSSGLRGRSAARARAGARLSGSCSAPSLAAPDGSAPPGPGAPAMR
AARKGRPGDQPPPRAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKTNLQFAGMSISLTVSTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKVPAFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKTPPPGGFVDVRLQARPHA
PDIAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGALDIYGMPEGKAHAAPGEAPTYVNA
QHLPPQATPASGSSAESSPRKDLFDMKPFEDALRNQSLGPVLSKAASVECISPVTPRAPD
AKMLEELEGEPWYQGEMSRKEAEGLLKNDGDFLVRKSATNPGSFVLTGMHNGQAKHLLLV
DPEGTIRTKDKVFDSISHLINHHLENSLPIVSAGSELCLQQPVEKAP
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgacgac
cttctgcacaacctgtcggtgagcggcggcggcaaggtctcggcggcgcgcgcggccccg
gcggcggccccctacctggtgtccggagacgcgctgcgccgggcgcccgacgatgggccg
ggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggcctc
cgcgggcgctcggcggccagggcgcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggccgccccggacggcagcgcgccccccggccccggcgccccggccatgcgc
gccgccaggaagggccggcccggcgaccagccgccgccgcgcgccccgcacgccagcgac
caggtgctgggggccggagtcacctacgtcgtcaagtacttgggttgcattgaagttctc
cgctcaatgaggtctcttgacttcagcacaagaacacagattaccagggaagccatcagc
cgtgtgtgtgaagctgtccctggtgccaaaggagccttcaggaagagaaagcctcccagc
aaaatgctgtccagcatcctgggcaagaccaacctccagtttgcggggatgagcatctcg
ctgaccgtatcgaccgccagcctgaacctgcggacgcccgactccaaacagatcattgcg
aaccaccacatgcagtccatctccttcgcgtcagggggagacccggacacaacagactac
gtggcatatgtggcgaaggaccccgttaatcgcagagcgtgtcacattctggagtgctgc
gacgggctggcccaggatgtcatcggctccatcggacaggccttcgaactccgctttaag
caatatttgcagtgtccttccaaggtgcccgcattccacgaccgaatgcagagtctggat
gagccgtggactgaagaggagggggatggctcagaccacccatactacaacagcatccca
agcaagacacctcctccagggggcttcgtggatgtgcggctgcaggctagaccccatgcc
cccgacatagcccagtttgcaggaaaagagcaaacttactaccaggggagacacttagga
gacccgtttggcgaggactggcagcaaacaccggtcaggcaaggggccctggatatctac
ggcatgccggaggggaaagcgcacgcggcccccggagaagcccccacgtacgtgaacgcc
cagcacctcccgcctcaggccacgccggcgtcgggcagcagcgcagagagcagcccgcgg
aaggacctcttcgacatgaaaccttttgaagatgctctcaggaaccagtccttggggcct
gtgctgagcaaagcggcctccgtggagtgcatcagccccgtcacccccagagccccagat
gccaagatgctggaggagctggaaggggagccttggtaccaaggggagatgagccggaag
gaggccgaagggctgctgaagaacgacggggacttcctggtccggaaaagcgccaccaac
ccaggctccttcgtcctcacaggaatgcacaacggccaggccaagcacctgctgctcgtg
gacccggaaggcacgatccggacaaaggacaaggtcttcgacagcatcagccacctcatc
aaccaccacctggagaacagcctccccatcgtctccgcaggaagcgagctctgcctccag
cagccggtggagaaggctccgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161808
Entry
111161808         CDS       T05871                                 

Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04650  Natural killer cell mediated cytotoxicity
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05100  Bacterial invasion of epithelial cells
elk05214  Glioma
elk05220  Chronic myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111161808
   04014 Ras signaling pathway
    111161808
   04370 VEGF signaling pathway
    111161808
   04072 Phospholipase D signaling pathway
    111161808
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111161808
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111161808
   04062 Chemokine signaling pathway
    111161808
  09152 Endocrine system
   04910 Insulin signaling pathway
    111161808
   04915 Estrogen signaling pathway
    111161808
   04917 Prolactin signaling pathway
    111161808
   04926 Relaxin signaling pathway
    111161808
   04935 Growth hormone synthesis, secretion and action
    111161808
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111161808
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111161808
   05226 Gastric cancer
    111161808
   05214 Glioma
    111161808
   05220 Chronic myeloid leukemia
    111161808
   05224 Breast cancer
    111161808
  09165 Substance dependence
   05034 Alcoholism
    111161808
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111161808
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111161808
   01522 Endocrine resistance
    111161808
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 111161808
NCBI-ProteinID: XP_022381490
UniProt: A0A2Y9LII0
LinkDB
Position
Unknown
AA seq 583 aa
MTQGPGGRTPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRSPAAARTAGGAGAA
DSQPEPAGPAGVPALAAAVLGACEPRCAAPCPLPALSRCRAAGARGPRGARGVAGPPDAA
ADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTRE
AINRLHEAVPGIRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISTDGLHLSVPATRQI
IANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFELR
FKQYLHSPPRVVVAPERLTRPEDSAWGDEEESEHNYYNSIPGKEPPLGGLVDSRLTLTQP
CALGALGQGASPAQRDTCSLPWDLGASSAGPPGDGYVQADTRGPRDYEDHLYVNTQGLDA
PDVLQPEDSPKKDLFDMRPFEDALKLHECSVGAGTAAAPLPLEDQWPSPPTRRAPIAPTE
EQLRQEPWYHGQMSRRAAERLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEG
VVRTKDVLFESISHLIDYHLQSGQPIVAAESELHLRGVVRREP
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcacgccccccgcaccccctgcgccccccgagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgccgctccc
gcgggcttcctgggccggagcccggctgcagcgcgcacggctgggggcgcgggggccgcc
gactcccagcccgagccggccggcccggctggcgtcccggcgctggcggcggcggtcctg
ggcgcctgcgaaccgcgttgcgccgcgccttgcccgctgcccgcgctcagccgctgccgg
gccgccggggcccggggcccgcggggcgcgcggggggtggccgggcccccggacgcagcc
gccgacgagtggatccgcaaaggcagcttcatccacaagccggcgcacggctggctacac
ccagacgccagggtcctggggcccggggtctcctacatcgtgcggtacatgggctgcatc
gaagtgctgcgctccatgcgctctctggattttaacacccgcacccaggtgaccagggaa
gccatcaaccggctccatgaggcggtgcctggcatccggggctcctggaagaagaaggcc
cccaacaaagcgctggcctccatcctgggcaagagcaacctgcgcttcgctggcatgagc
atcgccgtgagcatctcaaccgacggcctccacctctcggtgcccgccacgcgccagatc
atcgccaaccaccacatgcagtccatctccttcgcgtcaggcggcgacacggacatgacg
gattacgtagcctatgtagccaaggatcccatcaaccagagagcctgccacatcctggag
tgctgcgagggccttgcccagagcatcatcagcaccgtgggccaagccttcgagctgcgc
ttcaaacagtacctgcacagccccccccgggtggtcgtggccccagaaaggctgaccagg
ccagaggactcggcctggggggatgaggaggaatcggaacacaattactacaacagcatc
ccagggaaggagccgcccctgggcgggctggtggactccaggctcacgctaactcagccc
tgtgccctcggggccctcggccagggagcatctcctgctcaaagggacacgtgcagcctg
ccgtgggacctgggcgcctccagtgctggcccgccgggggacggctacgtgcaggccgac
accaggggccccagagactacgaggaccacctgtacgtcaacacacagggcctggacgcc
ccagacgttctgcagccagaggacagccctaagaaggatctgttcgacatgcggcccttc
gaggatgctctcaagctgcacgagtgctctgtgggggcgggcacggcggcggcgcccctt
cccttggaggaccagtggcccagcccccccacccgccgggcccccatcgcccccacggag
gagcagctgcggcaggagccctggtaccacggccagatgagccgaagggcggcggagagg
ctgcttcgagccgacggggacttcctggtgcgcgacagtgtcaccaaccccgggcagtac
gtcctcaccggcatgcacgcggggcagcccaagcacctgctgctcgtggaccctgagggc
gtggtgcggaccaaggacgtgctctttgagagcatcagccatctgatcgactaccacctg
cagagtgggcagcccattgtggccgcggagagtgagctgcacctacgtggtgtggtcaga
cgggagccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162137
Entry
111162137         CDS       T05871                                 

Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04510  Focal adhesion
elk04650  Natural killer cell mediated cytotoxicity
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05100  Bacterial invasion of epithelial cells
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05220  Chronic myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111162137
   04014 Ras signaling pathway
    111162137
   04072 Phospholipase D signaling pathway
    111162137
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111162137
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111162137
   04062 Chemokine signaling pathway
    111162137
  09152 Endocrine system
   04910 Insulin signaling pathway
    111162137
   04915 Estrogen signaling pathway
    111162137
   04917 Prolactin signaling pathway
    111162137
   04926 Relaxin signaling pathway
    111162137
   04935 Growth hormone synthesis, secretion and action
    111162137
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111162137
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111162137
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111162137
   05226 Gastric cancer
    111162137
   05214 Glioma
    111162137
   05220 Chronic myeloid leukemia
    111162137
   05224 Breast cancer
    111162137
  09165 Substance dependence
   05034 Alcoholism
    111162137
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111162137
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111162137
   01522 Endocrine resistance
    111162137
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 111162137
NCBI-ProteinID: XP_022382042
UniProt: A0A2Y9L741
LinkDB
Position
Unknown
AA seq 623 aa
MRKRGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDESSPGGSVGNKGSPQPPY
PTLAPHLPAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETGLNRAGSTPPPQPDLVGHRATVLTPDACPLPGPGEPTPGSRQDGH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSFESEEV
PIDGPSEEREDREYYNEIPGKQPPAGGVSDVRLKVQATEHMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAPERGVQSHRDASLMKQTCQVDFFNDPCYINTQALQSRLGSTPN
QGSAHPLGSPWHREKAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKENNP
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgcgaaaacgcggtcaggacagcctggcaggacttgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaatgagtccatcacgtcc
ctggacgaaagcagccccggaggctccgtggggaacaagggctcgcctcagcctccctac
cccaccctggcacctcacctgccggctgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatggccagcgtgaagctggccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccagctcccagcagcccggcttcccctgagaccggtctaaacagggct
gggtccacacctccgccgcagccagacctggtggggcacagggcgactgtcttaactccc
gatgcctgcccccttcctggccctggggagccaaccccagggagcaggcaggacgggcac
tttctacagcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaagtactgcagtcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtctctggggcaaatggagccattaaaaagcgaaag
cctccggttaagttcctatcaacagttcttggcaaaagtaatcttcagttttctggaatg
aacattaaactgaccatctcaacatgcagcctcacattgatgaatattgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acggactatgttgcctatgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccgcagtgggatggcccaagatgtcataagcaccatagggcaggcttttgagctc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttttgaaagtgaggaggtg
cccattgacggtcccagcgaggagagagaagaccgcgagtactacaatgaaatcccaggg
aagcagccacctgcagggggcgtctccgacgtgcggctcaaagtccaagccacagaacac
atggcttactgccccattcggtgtgagaagttgtgctatttgcctgggaactccaagtgt
agcagtgtgtatgagaactgtttagaacaaagccgagcaataggtaatgcaccagagaga
ggagtgcagtcccatcgagatgcctcattaatgaagcagacatgtcaagtggatttcttc
aatgacccctgctacataaatacacaggctcttcaaagtagacttggctctaccccaaat
cagggctcagctcaccccctggggagcccatggcaccgtgaaaaagcaccggaaactgtt
cagccaggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccacggcaagctgagcaggaaggcagcagagagcctgttg
gtaaaggatggggacttcctggttcgagagagtgcaacatctcctggccagtatgtgcta
agtggactacagggaggccaggcaaagcatcttctcctggtggatcccgaaggcaaggta
aggaccaaggatcatgtgtttgataatgtcggccatcttatcagataccacatggataac
agtttgccaatcatttcttctggaagcgaagtaagccttaaacaaccagtgagaaaagaa
aataatccatga

DBGET integrated database retrieval system