KEGG   Enhydra lutris kenyoni (northern sea otter): 111138943
Entry
111138943         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111138943
   04024 cAMP signaling pathway
    111138943
   04022 cGMP-PKG signaling pathway
    111138943
   04151 PI3K-Akt signaling pathway
    111138943
   04152 AMPK signaling pathway
    111138943
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111138943
   04922 Glucagon signaling pathway
    111138943
   04915 Estrogen signaling pathway
    111138943
   04926 Relaxin signaling pathway
    111138943
   04935 Growth hormone synthesis, secretion and action
    111138943
   04918 Thyroid hormone synthesis
    111138943
   04928 Parathyroid hormone synthesis, secretion and action
    111138943
   04916 Melanogenesis
    111138943
   04925 Aldosterone synthesis and secretion
    111138943
   04927 Cortisol synthesis and secretion
    111138943
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111138943
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111138943
  09156 Nervous system
   04725 Cholinergic synapse
    111138943
   04728 Dopaminergic synapse
    111138943
  09149 Aging
   04211 Longevity regulating pathway
    111138943
  09159 Environmental adaptation
   04714 Thermogenesis
    111138943
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111138943
  09162 Cancer: specific types
   05215 Prostate cancer
    111138943
  09164 Neurodegenerative disease
   05016 Huntington disease
    111138943
   05020 Prion disease
    111138943
  09165 Substance dependence
   05030 Cocaine addiction
    111138943
   05031 Amphetamine addiction
    111138943
   05034 Alcoholism
    111138943
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111138943
   04934 Cushing syndrome
    111138943
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111138943
   05161 Hepatitis B
    111138943
   05163 Human cytomegalovirus infection
    111138943
   05165 Human papillomavirus infection
    111138943
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111138943
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111138943
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf FTA4 DUF724 EMP24_GP25L Jnk-SapK_ap_N DUF2514 ZapB YabA
Other DBs
NCBI-GeneID: 111138943
NCBI-ProteinID: XP_022346675
UniProt: A0A2Y9IKY3
LinkDB
Position
Unknown
AA seq 384 aa
MEFRTPDLLDVWLEPPEEVSAGAFLELGLPCPAPELPGPQLREPGGWEPSGGRGCGLQAS
EPEDFLPLFIDPNEVDRSEASRGIDRAISKDPGLAHSSPALCEVVYEAGGLERRQTEAGP
AVGLISLQLGPRSPPCTAPAACSVGELPLAAHAHTLPRVGAVNPVPPATLLPCHTLFLTE
EEKRLLGQEGVSLPSHLPLTKAEERALKKVRRKIRNKQSAQDSRRRKKEYIDGLESRAAA
CSAQNQELQKKVRELERHNIALEAQLHRLRMLTAQTSSKAAQTGACVLILLFSLALIILP
SVSPLQGLREAGTNDHQPQGVISRNILTHKDMTENLESTAVEPGLEGPPRATGVNGSTRN
LLEKRGGKTGPSGHVRTVLHADEM
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggagttccgaacccccgacctgctggacgtgtggctggagcccccagaagaggtctca
gcaggagccttcctggagctgggactcccctgccccgccccggagctcccagggcctcag
ctccgagagcctggaggctgggagcccagcgggggacggggctgtggccttcaggcgagt
gagcccgaagacttcctgccgctgttcattgatcccaatgaagtggaccgctcagaggcc
tctcgtggcattgacagggccatctccaaggaccctggcctcgcacacagttccccggct
ctctgtgaggttgtctatgaggcagggggcctggagaggcggcaaacggaagctgggccg
gctgtagggctcatctctctccagctaggtccacggagcccaccatgtacggcgcctgct
gcctgctctgtcggggagctgcccctcgctgctcatgctcacacgctacccagagtgggc
gctgtaaacccagtgcctcccgcgaccctgctgccctgtcacacgttgttcctgacagag
gaggagaagcgtctgctgggacaggaaggggtttccctgccgtctcacctgcccctcact
aaggcagaggagagggccctcaagaaggtcaggaggaagatccgtaacaagcagtcggcg
caggacagtcggcgacggaagaaagagtacatcgacgggctggagagcagagcagctgcc
tgttctgcacagaaccaggaactacagaagaaagtccgggagctggagaggcacaatatc
gctctggaagctcagctccaccggctgcggatgctcactgcccagacctccagcaaagct
gcccagaccggcgcttgtgttctgatcctccttttttctctggccctcatcatcctgccc
agtgtcagccccttgcagggtctccgggaagctggcaccaatgatcaccagccacaggga
gtgatttccagaaatatcctgactcacaaggacatgacagaaaacttggagtccacagcg
gtagagcccggattggaggggccacctagggccacgggtgtcaatggctcaacaaggaac
ctgctggagaagaggggagggaagacaggccccagtgggcatgtcagaactgtcctgcat
gcagatgagatgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142901
Entry
111142901         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111142901
   04668 TNF signaling pathway
    111142901
   04022 cGMP-PKG signaling pathway
    111142901
   04151 PI3K-Akt signaling pathway
    111142901
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111142901
   04922 Glucagon signaling pathway
    111142901
   04915 Estrogen signaling pathway
    111142901
   04926 Relaxin signaling pathway
    111142901
   04935 Growth hormone synthesis, secretion and action
    111142901
   04918 Thyroid hormone synthesis
    111142901
   04928 Parathyroid hormone synthesis, secretion and action
    111142901
   04925 Aldosterone synthesis and secretion
    111142901
   04927 Cortisol synthesis and secretion
    111142901
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111142901
  09156 Nervous system
   04728 Dopaminergic synapse
    111142901
  09149 Aging
   04211 Longevity regulating pathway
    111142901
  09159 Environmental adaptation
   04714 Thermogenesis
    111142901
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111142901
  09164 Neurodegenerative disease
   05020 Prion disease
    111142901
  09165 Substance dependence
   05030 Cocaine addiction
    111142901
   05031 Amphetamine addiction
    111142901
   05034 Alcoholism
    111142901
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111142901
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142901
   05161 Hepatitis B
    111142901
   05163 Human cytomegalovirus infection
    111142901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111142901
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111142901
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 111142901
NCBI-ProteinID: XP_022351995
UniProt: A0A2Y9J1N7
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEIPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPASQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagatttttgaaaaactgtgaa
gaagtgggtttgtttaatgaactggcaagtccatttgagaatgaattcaagaaagcctct
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaaataccattggcacaaactgcacagcccaca
tcggctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgat
tcaagtgtaattattcagcaagcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaatcgttcctgtaccaggcccatttcctcttctattgcat
cttcctaatggacagaccatgcctgttgctattcctgcatcaattactagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggtccttcctcccctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttagaactcagtcagaggaatcaagaccacagtcattacaacagccagctaca
tccactacagaaactccggcttctccagctcacacaactccacagacccagaatacgagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaaatttctagag
cgaaatagagcagccgcttcacgatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtagcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcataccgccgataaagatgatagttcagaagac
ctgtcagtgccaagtagtccacatacggaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcaacctccaaggccgaagcagtggccacctcagtcctcacgcagatg
gcggaccagagtacagagcctgcactttcgcagattgttatggctcctgcctcccagtca
cagccctcaggaagttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111146280
Entry
111146280         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111146280
   04024 cAMP signaling pathway
    111146280
   04022 cGMP-PKG signaling pathway
    111146280
   04151 PI3K-Akt signaling pathway
    111146280
   04152 AMPK signaling pathway
    111146280
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111146280
   04922 Glucagon signaling pathway
    111146280
   04915 Estrogen signaling pathway
    111146280
   04926 Relaxin signaling pathway
    111146280
   04935 Growth hormone synthesis, secretion and action
    111146280
   04918 Thyroid hormone synthesis
    111146280
   04928 Parathyroid hormone synthesis, secretion and action
    111146280
   04916 Melanogenesis
    111146280
   04925 Aldosterone synthesis and secretion
    111146280
   04927 Cortisol synthesis and secretion
    111146280
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111146280
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111146280
  09156 Nervous system
   04725 Cholinergic synapse
    111146280
   04728 Dopaminergic synapse
    111146280
  09149 Aging
   04211 Longevity regulating pathway
    111146280
  09159 Environmental adaptation
   04714 Thermogenesis
    111146280
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111146280
  09162 Cancer: specific types
   05215 Prostate cancer
    111146280
  09164 Neurodegenerative disease
   05016 Huntington disease
    111146280
   05020 Prion disease
    111146280
  09165 Substance dependence
   05030 Cocaine addiction
    111146280
   05031 Amphetamine addiction
    111146280
   05034 Alcoholism
    111146280
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111146280
   04934 Cushing syndrome
    111146280
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146280
   05161 Hepatitis B
    111146280
   05163 Human cytomegalovirus infection
    111146280
   05165 Human papillomavirus infection
    111146280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111146280
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111146280
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ADIP
Other DBs
NCBI-GeneID: 111146280
NCBI-ProteinID: XP_022357471
UniProt: A0A2Y9JA65
LinkDB
Position
Unknown
AA seq 353 aa
MELALDLGDQDLLDFLLEESGDLEAEQPLSETLSEWEAEDFLSSLLSPAASLNDLSSSNS
CLVLHDHTYSLSQQHVSIDLDGGNYGKEGAQTTPLRVEEPAEQEIARLILTDEEKRLLEK
EGLTLHGTLPLTKMEEQVLTRVRRKIRNKKSAQESRRKKKVYLGGLESRVLKYTAQNLEL
QNKVQLLEEQNLSLLDQLRRLQAMVVQISNKTSSTSTCVLVLLFSFCLIIVPAMYSSDTR
GSLLAERGVLSRQLRALPSEDPRQLELPALQSEAPKDSSDQELQAPGNSCCLIFHMPQTP
GSESPVKLPLPVPSSESPCPGPVLPLHVNFTRGRGWLPPHSPTSVILQGRYSG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggaactggcgttggacttgggtgaccaggacctgctggacttcctgctagaggaaagc
ggagatttggaggccgagcagccactttccgagacactgagtgaatgggaggcagaggat
ttcctgagttccctgctgagtcccgccgcatcgttgaacgaccttagctcctctaattcc
tgtcttgttctccatgatcacacgtactctctctcacagcagcatgtctccatagatcta
gatggtgggaactatggaaaagagggggcccagacgactccactgcgtgtggaggagcct
gcagagcaggaaattgctaggctgatactgacagatgaggagaagaggctgttggagaag
gaggggcttactctgcatgggacacttcctcttactaagatggaggaacaagttctgaca
cgagtgcggaggaaaattagaaacaaaaagtctgctcaagagagccgcaggaagaagaag
gtgtatttgggaggtttagagagcagggtcttgaaatatacagcccagaatctggagcta
cagaacaaagtacagctcctagaggaacagaatttgtcccttctggaccagctgaggaga
cttcaggccatggtggttcagatatcaaacaaaacgagcagtaccagcacctgtgtcttg
gttctacttttctccttctgtctgatcatcgtacctgctatgtactcctctgacacaagg
gggagcctcctggctgagcgtggagtgttgtcccgccagcttcgtgccctccccagtgag
gatccccgccagctggagctgcctgccctgcagtcagaggcaccgaaggacagctcagac
caggagctccaggctcctggcaactcttgctgcctgatcttccacatgcctcagactcct
ggttctgagtctcccgtgaagctaccacttcctgtcccttcctcagagtccccctgccca
ggtcctgtccttcccctgcatgtaaattttacaagaggtaggggatggctccctcctcac
agccccacatctgttatcttacagggcagatattcaggctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147321
Entry
111147321         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111147321
   04024 cAMP signaling pathway
    111147321
   04022 cGMP-PKG signaling pathway
    111147321
   04151 PI3K-Akt signaling pathway
    111147321
   04152 AMPK signaling pathway
    111147321
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111147321
   04922 Glucagon signaling pathway
    111147321
   04915 Estrogen signaling pathway
    111147321
   04926 Relaxin signaling pathway
    111147321
   04935 Growth hormone synthesis, secretion and action
    111147321
   04918 Thyroid hormone synthesis
    111147321
   04928 Parathyroid hormone synthesis, secretion and action
    111147321
   04925 Aldosterone synthesis and secretion
    111147321
   04927 Cortisol synthesis and secretion
    111147321
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111147321
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111147321
  09156 Nervous system
   04725 Cholinergic synapse
    111147321
   04728 Dopaminergic synapse
    111147321
  09149 Aging
   04211 Longevity regulating pathway
    111147321
  09159 Environmental adaptation
   04714 Thermogenesis
    111147321
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111147321
  09162 Cancer: specific types
   05215 Prostate cancer
    111147321
  09164 Neurodegenerative disease
   05016 Huntington disease
    111147321
   05020 Prion disease
    111147321
  09165 Substance dependence
   05030 Cocaine addiction
    111147321
   05031 Amphetamine addiction
    111147321
   05034 Alcoholism
    111147321
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111147321
   04934 Cushing syndrome
    111147321
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147321
   05161 Hepatitis B
    111147321
   05163 Human cytomegalovirus infection
    111147321
   05165 Human papillomavirus infection
    111147321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111147321
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111147321
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 111147321
NCBI-ProteinID: XP_022359017
UniProt: A0A2Y9JDB1
LinkDB
Position
Unknown
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFNELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSAVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaatttagagcaggagaggccattcgtctgcagtgccccgggctgctctcagcgcttc
cccacagaggaccatctgatgattcatagacacaagcatgaaatgactttgaagttcccc
tcaataaaaacagacaatatgttatcagatcagactccgactccaacgagattcctgaag
aactgcgaggaagtggggctcttcaatgagctggactgctccctagaacatgagttcagg
aaggctcaggaggaggagagcagcaagcggaatatctcgatgcataacacagttggtggg
gccatggcggggcccggagctcaccagcttggcagcacccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacacaggca
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctacatctc
cacaacagacagagacagcccatgccagcctccatgcctgggaccctgcccaacccgacg
atgccgggttcttctgccgtcttgatgccaatggagagacagatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctgagcaacccctgtgcttctccccaggtccagcca
atgcattcagaagccaaaatgaggttgaaggccgcgttgactcaccaccctgctgccatg
tccaatgggaatatgaacaccatgggacacatgatggaaatgatgggctcccggcaggac
cagacgccacaccatcacatgcactcacacccgcatcagcaccagacactgccagcccat
cacccgtacccacaccagcaccagcacccagcccaccaccctcaccctcaaccccatcac
cagcagaaccacccacatcatcactcccactcccacctccacgcgcaccctgcacatcac
cagacctcgccacacccacccctgcactccggcaaccaagcacaggtctcaccagcgaca
caacagatgcagccaacccagacaatacagccgccccagcccacagggggccgccggcga
agggtggtggacgaggatcctgacgagaggcggaggaaatttctggaacggaaccgggca
gctgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagca
gaagaactcacccagacaaacatgcagcttcagaatgaagtgtccatgttgaaaaatgag
gtggcacagctgaaacagttgttgttaacgcataaagactgtccaataacagccatgcag
aaagaatcacaaggatatctaagtccagagagcagccctcctgccagtcctgtcccagct
tgctctcagcagcaggtcatccaacacaataccatcaccacttcctccgccgtgagcgag
gtggtggggagctccaccctcagtcagctcaccactcacagaacagacctgaatcccatc
ctttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147575
Entry
111147575         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04380  Osteoclast differentiation
elk04612  Antigen processing and presentation
elk04668  TNF signaling pathway
elk04710  Circadian rhythm
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111147575
   04024 cAMP signaling pathway
    111147575
   04022 cGMP-PKG signaling pathway
    111147575
   04151 PI3K-Akt signaling pathway
    111147575
   04152 AMPK signaling pathway
    111147575
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111147575
  09152 Endocrine system
   04911 Insulin secretion
    111147575
   04922 Glucagon signaling pathway
    111147575
   04915 Estrogen signaling pathway
    111147575
   04926 Relaxin signaling pathway
    111147575
   04935 Growth hormone synthesis, secretion and action
    111147575
   04918 Thyroid hormone synthesis
    111147575
   04928 Parathyroid hormone synthesis, secretion and action
    111147575
   04916 Melanogenesis
    111147575
   04924 Renin secretion
    111147575
   04925 Aldosterone synthesis and secretion
    111147575
   04927 Cortisol synthesis and secretion
    111147575
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111147575
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111147575
  09156 Nervous system
   04725 Cholinergic synapse
    111147575
   04728 Dopaminergic synapse
    111147575
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111147575
  09149 Aging
   04211 Longevity regulating pathway
    111147575
  09159 Environmental adaptation
   04710 Circadian rhythm
    111147575
   04713 Circadian entrainment
    111147575
   04714 Thermogenesis
    111147575
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111147575
  09162 Cancer: specific types
   05215 Prostate cancer
    111147575
  09164 Neurodegenerative disease
   05016 Huntington disease
    111147575
   05020 Prion disease
    111147575
  09165 Substance dependence
   05030 Cocaine addiction
    111147575
   05031 Amphetamine addiction
    111147575
   05034 Alcoholism
    111147575
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111147575
   04934 Cushing syndrome
    111147575
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111147575
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147575
   05161 Hepatitis B
    111147575
   05163 Human cytomegalovirus infection
    111147575
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147575
   05165 Human papillomavirus infection
    111147575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111147575
   03029 Mitochondrial biogenesis [BR:elk03029]
    111147575
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111147575
Mitochondrial biogenesis [BR:elk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    111147575
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 111147575
NCBI-ProteinID: XP_022359432
UniProt: A0A2Y9JEG1
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggcgttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagagaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttcagatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagcgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
atcctacagtacgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtc
gtcgttcaagctgcctctggagatgtacagacataccagatccgcacagcgcccactagc
accatcgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaac
caaaataagacactcattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111150050
Entry
111150050         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111150050
   04024 cAMP signaling pathway
    111150050
   04022 cGMP-PKG signaling pathway
    111150050
   04151 PI3K-Akt signaling pathway
    111150050
   04152 AMPK signaling pathway
    111150050
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111150050
   04922 Glucagon signaling pathway
    111150050
   04915 Estrogen signaling pathway
    111150050
   04926 Relaxin signaling pathway
    111150050
   04935 Growth hormone synthesis, secretion and action
    111150050
   04918 Thyroid hormone synthesis
    111150050
   04928 Parathyroid hormone synthesis, secretion and action
    111150050
   04916 Melanogenesis
    111150050
   04925 Aldosterone synthesis and secretion
    111150050
   04927 Cortisol synthesis and secretion
    111150050
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111150050
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111150050
  09156 Nervous system
   04725 Cholinergic synapse
    111150050
   04728 Dopaminergic synapse
    111150050
  09149 Aging
   04211 Longevity regulating pathway
    111150050
  09159 Environmental adaptation
   04714 Thermogenesis
    111150050
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111150050
  09162 Cancer: specific types
   05215 Prostate cancer
    111150050
  09164 Neurodegenerative disease
   05016 Huntington disease
    111150050
   05020 Prion disease
    111150050
  09165 Substance dependence
   05030 Cocaine addiction
    111150050
   05031 Amphetamine addiction
    111150050
   05034 Alcoholism
    111150050
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111150050
   04934 Cushing syndrome
    111150050
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111150050
   05161 Hepatitis B
    111150050
   05163 Human cytomegalovirus infection
    111150050
   05165 Human papillomavirus infection
    111150050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111150050
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111150050
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 111150050
NCBI-ProteinID: XP_022363084
UniProt: A0A2Y9JU67
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATPPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPVAADSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDIGGNGTSPDFSHPKEWFRERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgcggaaaacatggaggacttctctaacgacctgttcagcagtttctttgat
gatccggtgctggacgagaagagccctctactggacatggaactggactcccccacgcca
ggcatccaagctgagcacagctactccctgagcggtgactcagcgcctcagagccccctc
gtgcccatcaagatggaggacaccacccaagacgtggaacatggagcatgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgcctcctcggccatggccgctgctgccgccatggccacccccccgctgctgggc
ctcagccccctgtccaggctgcccatcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagcagagccccaggaggtgaatcagttcctcaaagtgacaccggaggac
ctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcgtccacggcc
atctccacttccccccttctcaccgcccctcacaaactacaggggacatcagggccactg
ctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagccgaagaaaaggccttaaagagggtccggagaaaaatcaagaat
aagatctcggcccaggagagccgccgtaagaagaaggagtacgtggaatgtctagaaaag
aaggtggagacatttacatcagagaacaacgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaagctccagactctggtcaccaacaag
atctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgcttcgttctggtgctgggctcccttgtgccctgcctccctgagttctcctccagc
tcccagactgtgaaggaagaccccgtggctgctgacagcgtctacacagccagtcagatg
ccctccaggagcctcctgttctacgatgagggggcaggctcgtgggaggatggccgcagt
gccctgctgcccgtggagcccccagacggctgggagatcaagccgggagggccagctgag
cagcggccccaggaccacctgcagcatgaccacctggacagcacccacgagaccaccaag
tacctgagcgaggcctggccgaaagacatcggtggaaacggcaccagcccggacttctct
caccccaaggagtggttccgtgagagggatctcggccccaataccaccatcaaactctcc
tag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151973
Entry
111151973         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111151973
   04024 cAMP signaling pathway
    111151973
   04022 cGMP-PKG signaling pathway
    111151973
   04151 PI3K-Akt signaling pathway
    111151973
   04152 AMPK signaling pathway
    111151973
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111151973
   04922 Glucagon signaling pathway
    111151973
   04915 Estrogen signaling pathway
    111151973
   04926 Relaxin signaling pathway
    111151973
   04935 Growth hormone synthesis, secretion and action
    111151973
   04918 Thyroid hormone synthesis
    111151973
   04928 Parathyroid hormone synthesis, secretion and action
    111151973
   04916 Melanogenesis
    111151973
   04925 Aldosterone synthesis and secretion
    111151973
   04927 Cortisol synthesis and secretion
    111151973
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111151973
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111151973
  09156 Nervous system
   04725 Cholinergic synapse
    111151973
   04728 Dopaminergic synapse
    111151973
  09149 Aging
   04211 Longevity regulating pathway
    111151973
  09159 Environmental adaptation
   04714 Thermogenesis
    111151973
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111151973
  09162 Cancer: specific types
   05215 Prostate cancer
    111151973
  09164 Neurodegenerative disease
   05016 Huntington disease
    111151973
   05020 Prion disease
    111151973
  09165 Substance dependence
   05030 Cocaine addiction
    111151973
   05031 Amphetamine addiction
    111151973
   05034 Alcoholism
    111151973
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111151973
   04934 Cushing syndrome
    111151973
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111151973
   05161 Hepatitis B
    111151973
   05163 Human cytomegalovirus infection
    111151973
   05165 Human papillomavirus infection
    111151973
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111151973
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111151973
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 111151973
NCBI-ProteinID: XP_022365932
UniProt: A0A2Y9JXS3
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYPTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPCPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTSGDSVNDDEVESEKWYLSTDF
PSTTIKTEPITEEPPPGLVPSVTLTITAISTPFEKEGPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVEHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAVA
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFLQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPLEEPSSPASAGELGHWDRGSSLLRASGLEARPDVDLPHFIISN
ETSLEKSMLLELQQHLVNAKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctctaatgtaccctacgcacttctcagaactcctg
gatgagttttcccagaacgtgctgggtcagctcctgaatgaccctttcctctcagagaag
agtgtgtcgatggaggtggagccgtgcccgacatcccccgcgcctctcatccaggccgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccgttcacccacgttacctcc
ggtgacagcgtcaatgacgatgaagtggaaagtgagaaatggtacctgtctacagacttt
ccatcaaccaccatcaagacagagccgattacagaggagccgcccccaggacttgttccc
tccgtcactctgaccatcacagccatctccaccccttttgagaaggagggacccccgctg
gaaatgaatactggggttgattcctcgtgccagaccattatacctaagatcaagctggag
ccccatgaagtggatcagttcctcaacttctctccgaaagaagcctccgtggagcacctg
cacttaccccccacccctcccagcagccacagcagcgactcagagggcagcctgagcccc
aacccccgcctgcaccccttcggcctgccgcagacccacagccctgccagagccgtggcg
cgggccccttcggccctgtccagctcccctctcctcacggcccctcacaaactgcaaggg
tcaggtccactggtcctgacagaagaggagaagaggaccctgatcgccgagggctatccc
atccccaccaaattgcctctaacaaaatcagaggagaaagctttgaagaagattcggagg
aaaatcaagaacaagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctggagaacaccaatagaactctcctgcagcaactccaaaaacttcagactttg
gtgatgggcaaggtttcccgcacctgcaagttggcgggcacacagacaggcacgtgcctc
atggtggttgtgctatgctttgctgtcgcatttggcagcttccttcagggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattctctgcaggagccgtataca
gcctctgtcgtgagatccaggaatctgctgatctacgaagaacattccccgctggaagag
ccgtccagcccagcctcggctggggagcttgggcactgggaccgaggatcctctctactc
agggcatcaggcctggaggccaggcctgatgtggatcttccccatttcattatctccaat
gagaccagcctggagaaatccatgctgttggagctacagcaacacttggtcaacgccaaa
ctggaggggaacgagacactaaaagttgtagaactcgacagaagagtgaacgccactttc
taa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152366
Entry
111152366         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04141  Protein processing in endoplasmic reticulum
elk04151  PI3K-Akt signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111152366
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111152366
   04022 cGMP-PKG signaling pathway
    111152366
   04151 PI3K-Akt signaling pathway
    111152366
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111152366
   04915 Estrogen signaling pathway
    111152366
   04926 Relaxin signaling pathway
    111152366
   04935 Growth hormone synthesis, secretion and action
    111152366
   04918 Thyroid hormone synthesis
    111152366
   04928 Parathyroid hormone synthesis, secretion and action
    111152366
   04925 Aldosterone synthesis and secretion
    111152366
   04927 Cortisol synthesis and secretion
    111152366
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111152366
  09156 Nervous system
   04728 Dopaminergic synapse
    111152366
  09149 Aging
   04211 Longevity regulating pathway
    111152366
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152366
  09164 Neurodegenerative disease
   05020 Prion disease
    111152366
  09165 Substance dependence
   05030 Cocaine addiction
    111152366
   05031 Amphetamine addiction
    111152366
   05034 Alcoholism
    111152366
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111152366
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152366
   05161 Hepatitis B
    111152366
   05163 Human cytomegalovirus infection
    111152366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111152366
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111152366
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 111152366
NCBI-ProteinID: XP_022366586
UniProt: A0A2Y9K0D0
LinkDB
Position
Unknown
AA seq 718 aa
MMGRGGPWEPSHGGGRAGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDDVAEE
QTQLFRCPEQDVPFGSGSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSES
SHLSTEPSSQASGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGATSDDPSDVQTK
VEPVSPSSSINSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQIS
MGPPSDGSLGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLI
QGALRVQPEGPAPPASRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRR
KKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFL
LFIAFNFGPVSISEPPPAPVSPRMSREEPQPRRRLLEFSMQEPVQGVEPLQGSSLGPEEP
QPSAPGQPSFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQ
RGRRKIPQRAQERQKSQLRKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAI
DRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGSPGDYEEMMQI
ECEVMDTRVIHIKTSTVPPSLRKQPASTPGNSTGGPLPASAAGQARQASHQPLYLNHP
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgatggggagaggcgggccttgggaaccgtctcatggtggggggcgggcgggaaagatg
gcggaactgatgctcctcagcgagattgcggacccaacacgttttttcacggacaacttg
ctgagcccggaggactgggacagcaccttgtacactggcctggatgatgtggccgaggag
cagacgcagctcttccgctgcccagagcaggatgtcccgtttggcagcggctccctggat
gtggggatggatgtcagcccccctgagccaccttgggaccccctgcctatcttcccagat
cttcaggtgaagtctgagccatcttccccctgctcctcttcctccctcagttccgaatca
tcccatctttccacagagccctccagccaggcctctggtgtaggggaggtgctggttgtg
aagacagagtccttggcacccccactctgcctcctaggagatgatccaacatccccattt
gaaaccgtccagatcaatgtgggtgccacctctgatgacccctcagatgtccagaccaag
gtagaacctgtctctccatcttcctccatcaactctgaggcttccctgctctcagcagag
tcccccaaccaggcttttataggagaggaggtactggaagtgaagacagagtcaccgtcc
cctcaaggctgtctcctgcaggatgtcctgggccccccacttggaggtgtccagatcagc
atgggcccaccctccgatggctccttaggcaaagccctgcccacccggaagccacccctg
cagcccaaacctgtggtgataaccaccgtcccgatgccacccagagctgtgcctcccagc
accaccatccttttgcagccccttgtccagccgcccccagtctccccagttgtcctcatc
caaggtgctcttcgggtccagcctgaggggccggccccccctgcttcaaggcctgagagg
aagagcattgttccagctcctatgcctgggaactcctgcccaccagaagtggatgcaaag
ctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtccaggagg
aagaagaaagagtatctgcaggggttggaggctcgactgcaggcggtgctggctgacaac
cagcagctccgccgggagaacgctgccctccggcggcggctggaggccctgctggctgag
aacagcgagctcaagttggggtctggaaacaggaaggtggtctgcatcatggtcttcctt
ctcttcattgccttcaactttggacctgtcagcatcagtgagcctcctccggctcctgtc
tctcctcggatgagcagagaggagcctcagccccggagacgcttgctggagttctcaatg
caagagccagttcagggagttgaacccctccagggttcctccctgggtcctgaggagccc
cagcccagcgctccaggccagccaagtttcagaaacctgacagccttccccgggggtgcc
aaggagctactgctgagagacctggaccagctcttcctctcctctgattgccggcatttc
aaccggacagagtccctgaggcttgctgatgagctgagcggctgggtccagcgccaccag
agaggccggcggaagattccccagagagcccaggagagacagaagtctcagctgcggaag
tcacctccagttaaggcagtccccacccaacctcctgggcccccagagagggattctgtg
ggccagctgcagctgtatcgccacccagaccgttcacagccagagttcctggacgccatt
gaccgacgagaagacacattttatgttgtgtccttccgaagagaccacttgctgctccct
gccatcagccataacaagacctctcggcccaagatgtccctggtgatgcctgccatggct
cccaatgagaccctgtcaggccgggggtccccaggggactatgaggagatgatgcagatc
gagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccctcg
ctccgaaaacagccagcctccaccccgggcaattccacaggtggccccttgccagcttct
gcagccggccaggcccgtcaggcctcccaccagcctctctacctcaatcacccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157635
Entry
111157635         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04137  Mitophagy - animal
elk04141  Protein processing in endoplasmic reticulum
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04720  Long-term potentiation
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04932  Non-alcoholic fatty liver disease
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111157635
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111157635
   04668 TNF signaling pathway
    111157635
   04022 cGMP-PKG signaling pathway
    111157635
   04151 PI3K-Akt signaling pathway
    111157635
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111157635
  09143 Cell growth and death
   04210 Apoptosis
    111157635
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111157635
   04922 Glucagon signaling pathway
    111157635
   04912 GnRH signaling pathway
    111157635
   04915 Estrogen signaling pathway
    111157635
   04926 Relaxin signaling pathway
    111157635
   04935 Growth hormone synthesis, secretion and action
    111157635
   04918 Thyroid hormone synthesis
    111157635
   04928 Parathyroid hormone synthesis, secretion and action
    111157635
   04925 Aldosterone synthesis and secretion
    111157635
   04927 Cortisol synthesis and secretion
    111157635
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157635
  09156 Nervous system
   04725 Cholinergic synapse
    111157635
   04728 Dopaminergic synapse
    111157635
   04720 Long-term potentiation
    111157635
   04722 Neurotrophin signaling pathway
    111157635
  09149 Aging
   04211 Longevity regulating pathway
    111157635
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111157635
  09162 Cancer: specific types
   05215 Prostate cancer
    111157635
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111157635
   05012 Parkinson disease
    111157635
   05014 Amyotrophic lateral sclerosis
    111157635
   05020 Prion disease
    111157635
   05022 Pathways of neurodegeneration - multiple diseases
    111157635
  09165 Substance dependence
   05030 Cocaine addiction
    111157635
   05031 Amphetamine addiction
    111157635
   05034 Alcoholism
    111157635
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111157635
   04934 Cushing syndrome
    111157635
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157635
   05161 Hepatitis B
    111157635
   05163 Human cytomegalovirus infection
    111157635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111157635
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111157635
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450 MCU AAA_13 bZIP_Maf Nop53 Laminin_II
Other DBs
NCBI-GeneID: 111157635
NCBI-ProteinID: XP_022374934
UniProt: A0A2Y9L0H4
LinkDB
Position
Unknown
AA seq 351 aa
MAEMSFLSSEVLVGDLMSPFDQSGLGAEEGLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFDSLFSIDDLETMPDELLATLDDTC
DLFDPLVQETNKEPPQTVNPIGHLPESLPKTDQIAPFTFLQPLPLSPGALPSTPDHSFSL
ELGSEVDISEGDRKSDSTAYITMIPQCIKEEDAPSDNDSGICMSPESYLGSPQHSPSTSR
GSPNRSLLSPGFLSGSARPKPYDPPGEKTAAKVKVEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagatgagtttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggaaggcctaggtctcttagacgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttctcc
gggacagattggatggtggagaaaatggatctgaaggagtttgattttgattctctgttc
agcatagatgacctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctcttcgaccccctagtccaggagacaaataaggagcccccccagacggtgaaccca
attggccatcttccagaaagtttacccaaaacagaccagattgccccctttaccttcctg
caaccacttcctctttccccaggggccctgccctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatttctgaaggagatagaaagtcagactctactgcttac
attaccatgatccctcagtgcatcaaggaggaggatgccccctcagataatgatagcggc
atctgtatgagtcctgagtcctatctggggtccccacagcatagcccctctacctccagg
ggctctccaaataggagcctgctgtctccaggtttcctctctggttctgcccgccccaaa
ccctatgatcctcctggagagaagacagcagcaaaagtaaaggttgagaaactagataag
aagctgaagaaaatggagcagaacaagacagcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggcgagtgcaaagagctggaaaagaagaatgaggctctg
aaagagcgggcagattctttagccaaggagatccagtatctgaaagatttgatagaagag
gtccgaaaggcaagggagaagaaaagggtcccctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161856
Entry
111161856         CDS       T05871                                 

Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04668  TNF signaling pathway
elk04714  Thermogenesis
elk04725  Cholinergic synapse
elk04728  Dopaminergic synapse
elk04911  Insulin secretion
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04922  Glucagon signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04931  Insulin resistance
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk05016  Huntington disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05034  Alcoholism
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111161856
   04024 cAMP signaling pathway
    111161856
   04022 cGMP-PKG signaling pathway
    111161856
   04151 PI3K-Akt signaling pathway
    111161856
   04152 AMPK signaling pathway
    111161856
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111161856
   04922 Glucagon signaling pathway
    111161856
   04915 Estrogen signaling pathway
    111161856
   04926 Relaxin signaling pathway
    111161856
   04935 Growth hormone synthesis, secretion and action
    111161856
   04918 Thyroid hormone synthesis
    111161856
   04928 Parathyroid hormone synthesis, secretion and action
    111161856
   04916 Melanogenesis
    111161856
   04925 Aldosterone synthesis and secretion
    111161856
   04927 Cortisol synthesis and secretion
    111161856
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111161856
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111161856
  09156 Nervous system
   04725 Cholinergic synapse
    111161856
   04728 Dopaminergic synapse
    111161856
  09149 Aging
   04211 Longevity regulating pathway
    111161856
  09159 Environmental adaptation
   04714 Thermogenesis
    111161856
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111161856
  09162 Cancer: specific types
   05215 Prostate cancer
    111161856
  09164 Neurodegenerative disease
   05016 Huntington disease
    111161856
   05020 Prion disease
    111161856
  09165 Substance dependence
   05030 Cocaine addiction
    111161856
   05031 Amphetamine addiction
    111161856
   05034 Alcoholism
    111161856
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111161856
   04934 Cushing syndrome
    111161856
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161856
   05161 Hepatitis B
    111161856
   05163 Human cytomegalovirus infection
    111161856
   05165 Human papillomavirus infection
    111161856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111161856
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111161856
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF1664 ZapB
Other DBs
NCBI-GeneID: 111161856
NCBI-ProteinID: XP_022381579
UniProt: A0A2Y9LDC2
LinkDB
Position
Unknown
AA seq 481 aa
MNGDLAAGKMASSGCPLDPIGSLELLDLLFDQQDGILRHVELGEDWDHVEDQQVLPGPDS
DDFLNSILGSGDSVPSSPIWSPAASDSGISEDLPSDPPDTPPRSGAVASPTSCHAAESAK
GLCPSYHPGPPCLASPPGPVAHVLEASVAIDLEMWSPDLCSEEQVEPADQPPCCNLTVKD
LLLSSSGATDLQQHHVAGPHLLRPGAEHCQELVLTEDEKKLLAKEGLTLPTQLPLTKYEE
RVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLE
QLKKLQAIVVQSTSKSAQTGTCLAVLLFSFALIVLPSISPFVTNKAENTGDYAPVRVFSR
TLHNNVASRVAPDVIPGSEAPGPWSKDGTSQEGSPGSPMADWESRGMSALGNLTKGLDNS
TLIPDNLTLARDNSTLAKDNLTLVPDNSMEKLKGATLLGWTAPEPALSSGRVGLEAAGEE
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatggggatttagcagctggaaagatggcttcctccggctgtcccttggaccctatt
ggcagcctggagctcctggatctcctgtttgatcagcaggatggcatcctgagacatgtg
gagctgggtgaggactgggaccacgtcgaggaccagcaggtcctgccaggcccagactct
gacgatttcctaaactccatcctgggttccggagactcggtgcccagctccccgatctgg
tcccctgcggccagtgacagtggcatctctgaagacttgccttccgaccccccagacacc
cctccacgcagcggggcagtcgcctcccccaccagctgccatgcggccgagtcagccaag
gggctctgcccctcctaccatcctggacccccctgccttgccagtccccctgggccagtg
gcccacgtgctggaggcctctgtggccatagacctggaaatgtggagcccggacctctgt
tccgaggagcaggttgagccggccgaccagcctccgtgctgcaacctcacggtgaaagat
ctcctgctctccagcagcggggccaccgacctgcagcagcatcacgtggcaggcccccac
ctgctgcgccccggggctgagcactgccaggagctggtgctgacagaggacgagaagaag
cttctggccaaagaaggcctcaccctgcccacccagctgcccctcaccaagtacgaggag
cgagtgctgaaaaaaatccggcggaaaatccggaacaaacagtcagcccaggagagccgg
aaaaagaagaaggaatatatagacggcctggaaactcggatgtcagcctgcacggcccag
aaccaggagctgcagaggaaggtcttgcatctcgagaagcagaacctgtccctcttggag
cagctgaagaaactccaggcaattgttgtccagtccaccagcaagtcggcccagacaggc
acctgcctagcggtcctgctgttctcctttgccctcatcgtcctgccctccattagccct
ttcgtcaccaacaaagccgagaacaccggagactacgcacctgttcgagttttctccaga
actttgcacaacaacgttgcctcccgcgtggcccccgacgtcataccaggctccgaggcc
ccaggaccgtggtccaaggatggcacatcccaggaagggtctccaggaagccccatggcg
gactgggaatctcggggcatgtcggctctgggcaacttgacaaagggtctggacaactcg
actctgatcccggacaacttgaccctcgcccgggacaactcgacactcgccaaggacaac
ttgacactggtcccggacaactcgatggagaagctgaaaggggccaccctgctgggctgg
actgcgcctgagccagcgctcagctctgggcgggtgggattggaggcagcaggggaggag
ctgtga

DBGET integrated database retrieval system