KEGG   Enhydra lutris kenyoni (northern sea otter): 111138952
Entry
111138952         CDS       T05871                                 

Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04659  Th17 cell differentiation
elk04932  Non-alcoholic fatty liver disease
elk05163  Human cytomegalovirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111138952
   04066 HIF-1 signaling pathway
    111138952
   04151 PI3K-Akt signaling pathway
    111138952
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111138952
   04061 Viral protein interaction with cytokine and cytokine receptor
    111138952
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111138952
   04659 Th17 cell differentiation
    111138952
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111138952
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111138952
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111138952
   05163 Human cytomegalovirus infection
    111138952
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111138952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111138952
   04090 CD molecules [BR:elk04090]
    111138952
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111138952
CD molecules [BR:elk04090]
 Proteins
  111138952
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 Ig_5 Big_4 I-set
Other DBs
NCBI-GeneID: 111138952
NCBI-ProteinID: XP_022346689
UniProt: A0A2Y9IHL9
LinkDB
Position
Unknown
AA seq 461 aa
MLALRCALLTALLAALGAVVVPGGCPAPEVASGAMTSLPGASVTLTCPGGEPGDDATVHW
QLEHPVAGSPRGSWAAVGRRLLLRSVQLSDSGNYSCYQDGRLAGTVHLLVDVPPEEPELT
CFRKSPLSKVACEWAPRNPPSPTTRATLLVRKFQSRPLGDSQEPCPYTQGLRKFSCQLEV
PEGDSSLYVVSLCISSSAGTKSSRLLTFEGYGILQPDPPANVTVTAVDGNPRWLRVTWRD
PPSWNSYFYRLQFELRYRAERSKTFTTWMVQEPRHQCTIHDAWKGLRHVVQLRAREEFGH
GSWSAWSPEASGTPWTEPRSPPAESEASSSTQAPTTSEDSGSNLSENSANATSLPVQDSP
SGPLPTFLVAGGSLAFGTLLCVGVVLRGDNSEFFRDVVVQAWGPPARPDHGRRCSGDCGC
FTGRGPLPERHSHGFLLIFFTVSKLATKVHDKPQRERYYDY
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgcgctgctgacagccctgctggccgcgctgggggccgtcgta
gtccccgggggctgccccgcgccggaggtggcgagcggtgcgatgaccagcctgcctggg
gccagcgtgaccctgacctgcccgggcggggagccgggagacgacgccaccgttcactgg
cagctggagcatcctgtggccggctccccgcggggcagctgggctgctgtgggaagaagg
ctgcttctgaggtctgtgcagctcagcgactctggaaactattcctgttaccaggacggc
cgcctggccggaaccgtgcatctgctggtggacgtgccccccgaggagcccgagctcacc
tgctttcggaagagtccgctcagcaaggtagcctgtgagtgggctccccggaacccaccc
tccccaaccaccagggccacgttactggtgaggaagtttcagagccgcccgctgggagac
tcccaggagccgtgcccctacacccaggggctccgcaagttctcctgccagctggaggtc
ccggagggggacagttccttgtacgtggtgtccctgtgcatcagtagcagtgctgggacc
aagtccagcaggctcctcacatttgagggctatggaatcctgcagcccgacccgccggcc
aacgtcaccgtcacggctgtggacggaaatccccgctggctccgtgtcacctggagagac
cccccctcctggaactcctatttctacaggctgcagtttgagctccggtaccgggctgag
cgctcgaagacctttaccacgtggatggtccaggagccccggcaccagtgcaccatccat
gatgcctggaagggcctgcggcacgtggtgcagctccgggctcgggaggagtttgggcac
ggctcctggagcgcttggagccctgaggccagcggcaccccttggacagaacccaggagc
cctccagctgagagcgaggcgtcctcctccacacaggcaccgaccaccagcgaggacagt
ggaagtaatctctctgaaaattctgcaaatgcaaccagcctcccagtgcaagactcgcct
tcagggccgctgcccaccttcctggtggccggaggaagcctggccttcgggacgctcctg
tgcgtcggtgtcgtgctgagaggcgacaacagtgaattcttcagggatgttgtggtccag
gcctgggggccaccagcaaggccagaccacggacgccgctgctcgggggactgtggctgc
ttcactgggcgggggcccctcccggaacgccattctcatgggttcttacttatttttttc
acagtaagtaaactggcaactaaagttcacgataaaccacaaagagaacgctactatgac
tattaa

DBGET integrated database retrieval system