KEGG   Enhydra lutris kenyoni (northern sea otter): 111138952
Entry
111138952         CDS       T05871                                 

Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04659  Th17 cell differentiation
elk04932  Non-alcoholic fatty liver disease
elk05163  Human cytomegalovirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111138952
   04066 HIF-1 signaling pathway
    111138952
   04151 PI3K-Akt signaling pathway
    111138952
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111138952
   04061 Viral protein interaction with cytokine and cytokine receptor
    111138952
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111138952
   04659 Th17 cell differentiation
    111138952
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111138952
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111138952
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111138952
   05163 Human cytomegalovirus infection
    111138952
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111138952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111138952
   04090 CD molecules [BR:elk04090]
    111138952
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111138952
CD molecules [BR:elk04090]
 Proteins
  111138952
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 Ig_5 Big_4 I-set
Other DBs
NCBI-GeneID: 111138952
NCBI-ProteinID: XP_022346689
UniProt: A0A2Y9IHL9
LinkDB
Position
Unknown
AA seq 461 aa
MLALRCALLTALLAALGAVVVPGGCPAPEVASGAMTSLPGASVTLTCPGGEPGDDATVHW
QLEHPVAGSPRGSWAAVGRRLLLRSVQLSDSGNYSCYQDGRLAGTVHLLVDVPPEEPELT
CFRKSPLSKVACEWAPRNPPSPTTRATLLVRKFQSRPLGDSQEPCPYTQGLRKFSCQLEV
PEGDSSLYVVSLCISSSAGTKSSRLLTFEGYGILQPDPPANVTVTAVDGNPRWLRVTWRD
PPSWNSYFYRLQFELRYRAERSKTFTTWMVQEPRHQCTIHDAWKGLRHVVQLRAREEFGH
GSWSAWSPEASGTPWTEPRSPPAESEASSSTQAPTTSEDSGSNLSENSANATSLPVQDSP
SGPLPTFLVAGGSLAFGTLLCVGVVLRGDNSEFFRDVVVQAWGPPARPDHGRRCSGDCGC
FTGRGPLPERHSHGFLLIFFTVSKLATKVHDKPQRERYYDY
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgcgctgctgacagccctgctggccgcgctgggggccgtcgta
gtccccgggggctgccccgcgccggaggtggcgagcggtgcgatgaccagcctgcctggg
gccagcgtgaccctgacctgcccgggcggggagccgggagacgacgccaccgttcactgg
cagctggagcatcctgtggccggctccccgcggggcagctgggctgctgtgggaagaagg
ctgcttctgaggtctgtgcagctcagcgactctggaaactattcctgttaccaggacggc
cgcctggccggaaccgtgcatctgctggtggacgtgccccccgaggagcccgagctcacc
tgctttcggaagagtccgctcagcaaggtagcctgtgagtgggctccccggaacccaccc
tccccaaccaccagggccacgttactggtgaggaagtttcagagccgcccgctgggagac
tcccaggagccgtgcccctacacccaggggctccgcaagttctcctgccagctggaggtc
ccggagggggacagttccttgtacgtggtgtccctgtgcatcagtagcagtgctgggacc
aagtccagcaggctcctcacatttgagggctatggaatcctgcagcccgacccgccggcc
aacgtcaccgtcacggctgtggacggaaatccccgctggctccgtgtcacctggagagac
cccccctcctggaactcctatttctacaggctgcagtttgagctccggtaccgggctgag
cgctcgaagacctttaccacgtggatggtccaggagccccggcaccagtgcaccatccat
gatgcctggaagggcctgcggcacgtggtgcagctccgggctcgggaggagtttgggcac
ggctcctggagcgcttggagccctgaggccagcggcaccccttggacagaacccaggagc
cctccagctgagagcgaggcgtcctcctccacacaggcaccgaccaccagcgaggacagt
ggaagtaatctctctgaaaattctgcaaatgcaaccagcctcccagtgcaagactcgcct
tcagggccgctgcccaccttcctggtggccggaggaagcctggccttcgggacgctcctg
tgcgtcggtgtcgtgctgagaggcgacaacagtgaattcttcagggatgttgtggtccag
gcctgggggccaccagcaaggccagaccacggacgccgctgctcgggggactgtggctgc
ttcactgggcgggggcccctcccggaacgccattctcatgggttcttacttatttttttc
acagtaagtaaactggcaactaaagttcacgataaaccacaaagagaacgctactatgac
tattaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140459
Entry
111140459         CDS       T05871                                 

Definition
(RefSeq) interleukin-20 receptor subunit alpha-like
  KO
K05136  interleukin 20 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140459
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140459
   04061 Viral protein interaction with cytokine and cytokine receptor
    111140459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111140459
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111140459
SSDB
Other DBs
NCBI-GeneID: 111140459
NCBI-ProteinID: XP_022348414
UniProt: A0A2Y9IM45
LinkDB
Position
Unknown
AA seq 283 aa
MGYSMYRYIHVGKEKHPANLILIYGNEFDKRFFVPAEKIVLNFITLNIVEDSNTSHQDVS
VRGKSNDVWDPNEPLEDQEPHQEEMEVKNSGYALHWMDIFCDSEESSKGMSLTQQGSLGG
TMATDKAAVGYEEAVRTVDICVGSGDQELRLQEEASLQGQFLEQQAALADLGSPTPLYSY
APQLRDLGQLLPKHVDAEEEPGEEAFTTLVDWDPQTGRLCIPSFSASEHDSEGCKKPEYK
ELTEESLLCRLYEDQAPEESSEENKAYLLKFMEDWGLHVQMED
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggctactccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttg
attttgatttatggaaatgaatttgacaaaagattctttgtacctgctgaaaaaattgtg
cttaattttatcaccctcaatattgtggaggattctaacacttctcatcaggatgtaagt
gtaaggggaaaaagcaacgatgtatgggacccgaatgagcccctcgaggaccaggagcca
catcaggaggaaatggaggtgaagaactcagggtatgctttacattggatggatattttc
tgtgactctgaggaaagctccaagggtatgtccctaacccagcaagggtcactgggtgga
acaatggccacagataaagctgccgttggatatgaagaggctgtaagaactgttgacatc
tgtgtggggtctggagatcaagagctcagactgcaggaagaggcatccctccaaggacaa
ttcttggagcaacaggcagctttggcagacctgggctccccaacaccactgtattcctat
gcccctcagctgcgagacttgggccagctgttgccgaagcacgtggatgcggaagaggag
ccaggtgaagaggcattcaccacactggtggactgggaccctcagactggcagactgtgc
ataccgtccttctctgcctctgaacatgactctgagggatgtaagaagcctgagtacaag
gagctcacagaagaaagcctcttgtgtagactctatgaggatcaggctccagaagagtcg
tcagaagaaaacaaagcctatctcctgaaatttatggaggactggggattacacgtgcaa
atggaggactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140848
Entry
111140848         CDS       T05871                                 

Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04072  Phospholipase D signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111140848
   04014 Ras signaling pathway
    111140848
   04015 Rap1 signaling pathway
    111140848
   04630 JAK-STAT signaling pathway
    111140848
   04020 Calcium signaling pathway
    111140848
   04072 Phospholipase D signaling pathway
    111140848
   04151 PI3K-Akt signaling pathway
    111140848
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111140848
   04540 Gap junction
    111140848
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111140848
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140848
   05206 MicroRNAs in cancer
    111140848
   05230 Central carbon metabolism in cancer
    111140848
   05231 Choline metabolism in cancer
    111140848
  09162 Cancer: specific types
   05214 Glioma
    111140848
   05218 Melanoma
    111140848
   05215 Prostate cancer
    111140848
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111140848
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111140848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111140848
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:elk04090]
    111140848
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111140848
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111140848
CD molecules [BR:elk04090]
 Proteins
  111140848
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 111140848
NCBI-ProteinID: XP_022348772
UniProt: A0A2Y9IJC4
LinkDB
Position
Unknown
AA seq 1113 aa
MPTPEGISSKDTMQLLSTRPAPVLKGQVLLLPLLLLLGPQSSWGLVITPPGPELVLNVSS
NFVLTCSGPAPVVWERMSQELPQKMAKTQDGTFSSTLTLTNVTGIDTGEYFCAYKGSHGL
EPGERKRLYIFVPDPTMGFLPVDPEELFIFLTEITEITIPCRVTDPKLVVTLHEKKVDVP
LPIPYDHQRGFSGTFEDKTYVCKTTIGDREVDSEAYYVYSLQVSSINVSVNAVQTVVRQG
ENITIMCIVTGNEVVNFEWTYPRMESGRLVEPVTDFLFNIPSHIRSILHIPAAELGDSGT
YICNVSESVNEHRDEKSINVTVVESGYVRLLGELDAVQFAELHRSRTLQVVFEAYPPPTV
MWFKDNRTLGDSSAGEISLSTRNVSETRYVSELTLVRVKVAEAGCYTVRVFHEDAEAQLS
FQLQVNVPVRVLELSESHPASGEQTVRCRGRGMPQPHLTWSTCSDLKSRCPRELPPTPLG
NSSEEESQLETNVTYWPEDQEFEVVSTLRLRRVDQPLSVRCTLHNLLGHDMQEVTVVPHS
LPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQL
PYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQA
LMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCSDK
RRPPSAELYSNALPVGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGGVKYADIE
SSSYMAPYDNYVPTAPERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDL
AARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVW
SFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEI
RPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLDTSSV
LYTAVQPNEGDNDYIIPLPDPKPEAADEGPLESSPSLASSTLNEVNTSSTISCDSPLEPQ
EEPEPQPEPLAEPQPPLDPSCPGPRAEAEDSFL
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgcccacacctgaaggcattagcagcaaggacaccatgcagcttctgagcaccaggcca
gctcctgtcctcaaaggccaggtgctgttgctgcccctgctgttgctgctgggcccacag
tcttcctggggcctggtcatcacacccccagggccagagcttgtcctcaatgtctccagc
aacttcgttctgacctgctcgggcccagctccagtggtgtgggaacggatgtcccaggag
ctcccacagaaaatggccaagacccaggatggcaccttctccagcacactgacactgacc
aatgtcactgggatagacacaggagaatacttctgcgcctacaaaggctcccatgggctg
gagcctggtgagcgaaaacggctctacatctttgtgccagatcccacgatgggctttctc
ccggttgaccccgaggaactattcattttcctcacggaaataactgagatcacaattccg
tgccgagtgacggatccgaagctggtggtgacactgcatgagaagaaagtggatgtccca
ctacccatcccctacgaccaccaacgtggcttctctgggacattcgaggataagacctat
gtctgcaaaaccaccatcggggacagggaagtggattctgaagcctactatgtctacagc
ctccaggtgtcatccatcaacgtctccgtgaatgcagttcagactgtggtccgtcagggt
gagaacatcaccatcatgtgcattgtgaccggaaacgaggtggtcaactttgaatggacc
tacccacgcatggagagtgggcggctggtggagccagtgactgacttcctcttcaatata
ccctcgcacatacgctccatcctgcacatccctgctgctgagcttggcgattcagggacc
tacatttgcaatgtatcagaaagtgtgaatgagcatcgggatgaaaagtccatcaatgtc
actgtggttgagagtggctacgtgcggctgctgggagagctggacgcggtacaattcgcg
gagctgcaccgcagccggactctgcaggtcgtgttcgaggcctacccgccgcccactgtc
atgtggttcaaggacaaccgcacgctaggcgactccagcgctggcgagatctccctgtcc
acacgcaacgtgtctgagacccgatacgtgtcggaactgacgctggtacgggtgaaggtg
gcagaggctggctgctacactgtgcgggtcttccatgaggacgcggaggcccagctctca
ttccagctgcaggtcaacgtgcctgtccgtgtgctggagctgagtgaaagccaccctgcc
agcggggagcagacggtccgctgtcgcggtcgtggcatgccccagccgcacctcacttgg
tctacctgcagcgacctcaaaagcagatgtccgcgtgaactgccgcccacgccgctgggg
aacagttcggaggaggagagccagctggagactaacgtgacatactggcccgaggaccag
gagttcgaggtggtgagcacactgcgcctgcgccgtgtggaccaaccgctgtctgtgcgc
tgcactctgcacaacctgctgggacacgacatgcaggaggtcaccgtggtgccacattct
ctgcccttcaaggtggtggtgatctcggccatcctggccttggtggtcctcacagtcatc
tccctcatcatccttatcatgctgtggcagaagaagccacgttacgagatccggtggaag
gtgattgaatccgtgagctccgacggccatgagtacatctatgtagatcctatgcagctg
ccgtatgactccacctgggagctgccaagggaccagcttgtgctcggacgcaccctgggc
tccggggcctttgggcaggtggtggaggccacggctcacggcctgagccactcgcaggcc
acgatgaaagtggcagtcaagatgctgaaatccacagcccgcagcagcgagaagcaggcc
ctcatgtcagagctgaagatcatgagtcacctcgggccccatctgaacgtggtcaacttg
ctgggggcctgcaccaaaggaggacccatctacatcatcactgagtattgccgctacggt
gaccttgtagactacctgcaccgcaacaagcacactttcctgcagcgctgctccgacaag
cgtcgcccgcccagcgccgagctctacagcaacgccctgcccgtcgggctcccgctgccc
agccatgtgtctctgcccggggagagcgacggtggctacatggacatgagcaaagatgag
tcggtagactacgtgcccatgttggacatgaaaggaggcgtcaaatatgcagacattgag
tcctctagctacatggccccttatgacaactacgtccccaccgctcctgagcggacctgt
cgggccactctgatcaacgagtccccagtgcttagctacacggatctcgtgggcttcagc
taccaggtggccaatggcatggagttcctggcctccaagaactgtgtccaccgagatctg
gcagccagaaatgtgctcatctgtgagggcaagctggtcaagatctgtgacttcggcctg
gctcgtgacatcatgcgagactcgaactatatctccaaaggcagcaccttcctgcctctg
aagtggatggcccccgagagcatcttcaacagtctctataccaccctgagcgacgtgtgg
tcctttgggatcctactctgggagatcttcaccctgggtggcaccccgtacccagagctg
cccatgaacgagcagttctataatgccatcaagcgggggtaccgcatggcccagcctgcc
cacgcctccgacgagatttatgagatcatgcagaagtgctgggaagagaagtttgagatc
cggcctcctttctcccagctggtgctgcttcttgagaggctgctgggcgaggggtacaag
aagaagtaccagcaggttgatgaggagtttctgaggagcgaccacccggccgtccttcgg
tcccaagcccgtttgcctggcttccatggcctccgatcgcccctggacaccagctctgtc
ctctacactgctgtgcagcccaatgagggtgacaatgactacatcatccccctgcctgac
cccaaacccgaggctgctgatgagggcccactggagagttctcccagccttgccagctcc
accctgaatgaagtcaacacctcctctaccatctcctgtgacagccccctggagccccaa
gaggagccggagccccagcccgagcccctggcggagccgcagcccccactggatccgagc
tgccccgggccccgggccgaggcagaggacagcttcctgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140951
Entry
111140951         CDS       T05871                                 

Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140951
   04151 PI3K-Akt signaling pathway
    111140951
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111140951
   04060 Cytokine-cytokine receptor interaction
    111140951
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111140951
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111140951
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111140951
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 111140951
NCBI-ProteinID: XP_022348932
UniProt: A0A2Y9IJW3
LinkDB
Position
Unknown
AA seq 645 aa
MRAAGPTGMDLWQVLLTLAVAGSGNAVSGSEATPAILGRASQSLQRVNPGPGTNSSGKPK
FTKCRSPELETFSCHWTDGVNHGLKNPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSC
YFNSSYTSIWIPYCIKLTSSGGTVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQ
VRWEPPPNADVRKGWIVLEYELQYKEINESQWKMMDPVLSTSVPVYSLRLDKEYEVRVRS
RQRNSEKYGEFSEALYVALPQMSPFACEEDFQFPWFLIIIFGIFGLTMILFLFIFSKQQR
IKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDD
PEEKTEGSDTVRLLNNDHEKSLNILGAKDDDSGRTSCYEPDLLETDFNASDVCDSTSEVA
QPQRLKGEDLLCLDQNSQNNSPSADTAPTTQQPSVILAKEDKPRPRLISGTESTHQAAHP
QLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGMSPCDSPPEVVSLCQANFIMDSA
YFSEADAKKCITVAPHVEAESRADPSFNQEDIYITTESLTTTAGQSGTAEQAPSSERPVP
DYTSIHIVQSPRGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgagagctgcgggtcctacaggtatggatctctggcaggtgctgttgaccttggcagtg
gcaggctcgggcaatgctgtttctgggagtgaagccacaccagcaatccttggcagagca
tcccagagtctgcaaagagttaatccgggaccagggacaaattcttctgggaagcctaag
ttcaccaagtgccgttcacctgaactagagactttttcatgccactggaccgatggggtt
aatcatggtttgaagaacccaggatccatacagctgttctatattagaaggagcactcaa
gaatggactcaagaatggaaagaatgccccgattatgtctctgctggagaaaacagctgc
tactttaattcatcttatacctccatttggattccctactgtatcaagctaaccagcagt
ggtggtacggtggatcaaaagtgtttctctgttgaggaaatagtgcaaccggatccaccc
attggcctcaactggactttactgaacgtcagtttaacggggattcatgcagatatccaa
gtgagatgggaaccaccacccaatgcagatgttcggaagggatggatagtcctggagtat
gagctgcagtacaaagaaataaacgagtcccagtggaaaatgatggaccctgtactgtca
acatcagttcccgtttactcgttgaggttggataaagaatatgaagtgcgtgtgagatcc
agacaacgaaattctgaaaagtacggcgagttcagtgaggcgctctatgtagcacttcct
cagatgagtccatttgcatgtgaagaagatttccagtttccatggttcttaattattatc
tttggaatatttgggctaacgatgatattatttttattcatattttctaaacagcaaagg
attaagatgctgattcttccccctgttccagttccaaagattaaaggaattgatccagat
ctcctcaaggaaggaaaattagaagaggtgaacacaatcttagccattcatgacaactat
aaacctgaattctacaacgatgactcttgggttgaattcattgagctggatattgatgac
ccagaagaaaagactgaaggatcagacacagtcagacttctcaacaatgaccatgagaag
tcactaaacatccttggggcaaaggatgatgattctggacgtaccagctgttatgaacct
gaccttctggagactgacttcaatgccagtgacgtatgtgacagtacttcagaggttgct
cagccacagaggttaaaaggggaagatctcttgtgccttgaccagaatagtcaaaataac
tcaccctctgctgatactgcccctaccactcagcagcccagtgttatcctggcaaaggaa
gacaaaccaagaccacgtcttatcagtggaactgagtcaactcatcaagctgcccatcct
cagctgagcaatccgagttcactggcgaacatcgacttttatgcccaggtaagcgacatt
actccagccgggagtgtggtcctttccccaggccaaaagaataaggcagggatgtcccca
tgtgacagtcctccggaagtggtctcactctgccaagcgaacttcatcatggacagtgcc
tacttcagcgaggcagatgccaaaaagtgcatcactgtggcccctcacgtcgaggctgaa
tcacgtgcagaccccagctttaaccaggaagacatttacatcaccacagaaagccttacc
actaccgctggccagtctgggacagcagagcaggctccgagctcggagaggccggtcccg
gactacacctccattcacatcgtgcagtctcctcggggcctcgtgctcaatgccacggcc
ttgcccttgcctgacaaggagtttctctcatcatgcggctacgtgagcacagaccaactg
aacaaaatcatgccgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140973
Entry
111140973         CDS       T05871                                 

Definition
(RefSeq) leukemia inhibitory factor receptor
  KO
K05058  leukemia inhibitory factor receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140973
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140973
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111140973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111140973
   04090 CD molecules [BR:elk04090]
    111140973
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111140973
CD molecules [BR:elk04090]
 Proteins
  111140973
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 111140973
NCBI-ProteinID: XP_022348968
UniProt: A0A2Y9IK25
LinkDB
Position
Unknown
AA seq 1097 aa
MMNLSSHLRRPSWMMDSKRMGMTSHFQWLLLTFTLLYLMNQVNSQKKGAPRDLKCVTNNL
RVWDCSWKAPSGAGHGTVYEVCIENRSHSCYQSEKTNTKIPALPPGDHEITINRLYDFGN
LISKFTLNEKNVSLIPDTPEILNLSADFSTSTLHLKWNDRGSVFPHHLNVIWEIKILRKE
NKEVVKLVTHNTTVNGKDTIHHWSWTSDMPLECTTHSVGIRCYVDDLHFSGRKEWSDWSP
LKNVSWSPDSQTKVFPQDKVILVGSDIIFCCVTQEKVLSAQIGQTNCPLIHLDGENVAIK
IRNISVSANSGTNVVFTTEDNIFGTVIFAGYPPDTPQKLNCETSDLKEIVCTWNPGRPTA
LVGPRNTSYTLFESFSGKYVRFKRVEAPTNESYQLFFQMHPNQEIYNFTLNAHNPLGRSE
STILVNITEKVCPRIPTSIKVKDINSTAVTLSWHLPGNFAKIKLLCQIEINKTNSVQELR
NVTIKGVENSSYLVAVDKLNPYTIYTFRIRCSTETFWKWSKWSNEKKYLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCLLDEETQSLSEIPDPQHKAELQLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKVEQAVGMGNGILLTWNYDPNMTCDYVIK
WCNSSRSEPCLMDWKKVPSNSTETVIESDQFRPGVRYKFFLYGCRNQGYQLLRSIIGYVE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFEKGERDTSKIRGLESGR
SDIKIKNITDLSQKTLRIADLQGKTSYHLVLRAYTDGGMGPEKSMFVVTKENSVGLIIAI
LIPVAVAVTVGVVTSVLCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEM
NPCTPNNVEVLETRSVVPKIEDTEIISPVAERRDESCDADAENHVVVSYCPPVIEEETAQ
PGAEEAGGTSQVVYIDIQSMYQPQAKPEEDQDSDPVGGAGYKPQMHLLVPATGADLGAED
DLDKTAGYRPQANVNNWNLVSPDSPRSTDSTSETASFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatgaacctttcctcacatttaagaagaccctcctggatgatggatagtaaaagaatg
gggatgacatcacatttccagtggctcttattaacatttactctcctatatttaatgaac
caagtaaatagccagaaaaaaggggcgcctcgtgatttgaagtgtgtaactaacaatttg
cgggtgtgggactgttcttggaaagcaccctctggagcaggccatggtactgtttatgaa
gtttgcattgagaacaggtctcattcttgttatcagtcagagaagacaaatactaagatc
cctgctcttccacctggtgatcatgaaataacaataaaccgtctgtatgattttggaaat
cttataagtaaattcacactaaatgaaaaaaatgtttctttaattccggacactccagag
atcttgaatttgtctgctgatttctcaacttccacattacacctaaagtggaatgacagg
ggttctgtttttccacatcacttaaatgtcatctgggaaattaaaattctacgtaaagaa
aataaggaagtcgtaaaattagtgacccacaacacaactgtgaatggtaaagatacaatt
caccactggagttggacctcagacatgcccttggagtgcaccactcattctgtgggaatt
aggtgctatgttgatgatcttcatttctctggtcgcaaagagtggagtgactggagccca
ctgaagaacgtttcttggtcacctgattcccagactaaggtttttcctcaagacaaagtg
atacttgtaggctcagatataatattttgttgtgtgactcaagaaaaagtgttatcagca
cagattggccaaacaaattgtccccttatccatcttgatggggaaaatgtggcgatcaag
atccgtaatatttctgtttctgctaatagtggaacaaatgtggtttttacaacagaagat
aacatatttgggactgttattttcgcaggatatccacctgatactcctcaaaaactgaat
tgtgagacctctgatttaaaagagattgtctgtacttggaatccaggaagaccaaccgca
ttggtgggcccacgcaatacgagttacactttatttgaaagtttttcggggaaatatgtt
agatttaaaagagttgaagcgccaacaaatgaaagctatcagttattctttcaaatgcat
ccaaatcaagaaatatataattttactttgaatgctcacaatcctctgggtcgatcagaa
tcaactattttagttaacataactgaaaaagtctgtcctcgtattcctacttcaatcaaa
gtgaaggatattaattcaacagctgttacactttcctggcatttaccaggcaactttgca
aagattaaacttttatgtcaaattgaaattaacaaaactaactcagtccaagaattgcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgtagctgtggacaagttaaat
ccatataccatatatactttccggattcgctgttctactgaaactttctggaaatggagc
aaatggagcaatgaaaaaaaatacttaaccacagaagccattccttcaaagggaccagat
acgtggagagagtggagttccgatggaaaaaatttgataatctactggaagcctttaccc
attaatgaagcaaatgggaaaatactttcctataatgtatcctgtttgcttgatgaggag
acacagtccctttctgagatccctgatcctcaacacaaggcagaactacaacttgataaa
aacgactacatcatcagtgtggtggcaaaaaattctgttggctcatcgccaccttctaaa
atagctagcatggaaattccaaacgatgatctcaaagtagagcaggctgtcggaatggga
aatggaattctcctcacttggaattacgatcccaatatgacttgtgactatgttattaaa
tggtgtaactcatctcggtctgaaccctgccttatggactggaaaaaagtcccttcaaac
agcactgaaactgtaatagaatctgatcagtttcgacctggtgtaagatacaagtttttt
ctgtatgggtgcaggaatcaagggtatcagttactgcgctctataattggatatgtagaa
gaactggctccaattgttgcgccaaatttcactgttgaggacacatctgcagattcgata
ctagtaaaatgggaagatattcccgtggaagagctcagaggctttttaagaggatactta
ttttactttgaaaaaggagagagagacacatctaaaataaggggtttggaatccggtcgg
tcagacataaagattaagaacattactgacctatcccagaagacactgagaattgctgat
cttcagggtaaaacaagttaccatctggtcctgcgagcctacacagatggtggcatgggc
ccagagaagagcatgttcgtggtgacgaaggaaaattctgtggggttaataatcgccatt
ctcatcccagtggccgtggctgtcaccgtgggagtggtcacgagtgtcctttgctatcgg
aaacgagaatggatcaaagaaaccttctaccctgatattccaaatccagagaattgtaaa
gctctgcagtttcagaagagtgtctgtgagggaaacagtgctctcaaaacattggaaatg
aatccttgtaccccaaataatgttgaggttctggaaactcgatcagtggttccgaaaata
gaagacacggaaataatctctccggtagccgagcggcgggacgagagctgtgatgcagat
gccgagaaccacgtggtcgtgtcctactgcccccctgtcattgaggaggaaacggcgcag
ccgggcgccgaggaggccggagggacctctcaggtcgtgtacatcgatatccagtctatg
taccagcctcaggcgaaaccagaggaagatcaagacagtgaccctgtcgggggcgccggc
tataagccccagatgcacctgctggtccctgctactggggcagacctcggcgcggaggac
gacttagataaaactgctggttacagacctcaggcaaatgtcaataactggaacttagtg
tctccagactctcccaggtccacagacagcaccagtgaaacggcctctttcggaagcccc
tgctccattaactccaggcagtttttgatccctcctaaagacgaagactccccgaagtcg
aacgggggagggtggtccttcacaaacttttttcagaacaaacccaacgactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141176
Entry
111141176         CDS       T05871                                 

Definition
(RefSeq) oncostatin-M-specific receptor subunit beta
  KO
K05057  oncostatin M receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141176
   04151 PI3K-Akt signaling pathway
    111141176
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141176
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111141176
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111141176
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N fn3_2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 111141176
NCBI-ProteinID: XP_022349257
UniProt: A0A2Y9IKQ9
LinkDB
Position
Unknown
AA seq 969 aa
MALSSVSQTAFLLALLSLRTYQSEVLSEPLPSAPEFLKVSVNSTCQCLHLQWTVHNLSHH
QEFRMVFQIEISRIKTSNVIWVENYTTTVKWNQVLHWSWESKLPLECAKHFIRMRSAVDT
AKTPGPRVWSSWSSWEEADVQNSLGQDPLFVFPKDKLVEEGSNVTICYVSKSHQNNISCY
LEGVRMQGEQLDPNVSVFNLNHVAFIRETGTNIYCKPGQGDRIKGTVLFVSKVLKEPKDF
SCETQDLTTLNCTWDPGSDTGLLKQLSQSYALFESFSGKKTLCKHKSWCLWQVAPESQDM
YNFTLTAENYLRKRSVHLLFNLTHRVHPMAPFNVLFKNVSATNATMTWKVHSIGKYHTLL
CQVELYGEGKVTQHNVSVKVDGAHLFSGLEPDMEYMAQVRCANGDHFWKWSEWTQQNFTT
AEAAPSEAPDVWRNVKTVQGRCVVTLFWKPLSKLQAHGKILFYNIVVDYLDRTSVSELLS
IPAPANGTELPLSQCSSQIRIMANNSVGTSPASVIVVSREPGNEEVEEERVKGTEDGFPL
SWKPQPRHVTGYLVEWCEHPQDPPCDLQWKNLGPNVTSTVVSSDAFRPGVRYNFRIYGIS
TERVPYLLARKTGYSQELAPSDNPQVVMTNLTSHSFTLSWKNYSTESQPSFIQGYHIYLK
SKAGWCHSGSEKAVLSDDAAVCCKYKIDNPEQKTFVVENLQPESFYEFLVTPYTSVGEGP
HDAFAKVTTPDEYSPTLIRIILPMVFCILLIMITCYLKSQWMKEKCYPDIPDPYKSSVLS
LIKSKENPHLTIMNIKDCVPDSIEVLNKQEGTRKSLTETESTKPTYLYLLPTEKRYSSPG
PCICFENFTYNQAASDSASCGHVPAPPKAPPSQLGLLTSPENLLKALEKNYMNSLGEIPA
GETSLNYVSQLASPMSGDKSNLPINPPEPALCSEYKMQMAIPLGLASPPSSGSSSLSSVT
LLDEGEHYH
NT seq 2910 nt   +upstreamnt  +downstreamnt
atggctctctcttcagtctctcagacagcattcctcttggcattgctgtccttgagaact
taccagagtgaagttttgtctgaacctttgccatctgctcctgaattcctgaaggtttcc
gtcaattctacatgtcagtgtttgcatttacaatggactgtccacaacctttctcatcat
caggaattcagaatggtttttcagatagaaatcagtagaattaaaacatctaatgtcatc
tgggtggagaactacaccaccactgtgaagtggaaccaggttctgcactggagctgggaa
tccaagctccccttggaatgtgcgaaacattttataagaatgaggagtgcggtagatact
gccaagacccccgggccaagggtctggagcagctggagttcgtgggaggaagcagatgta
cagaattctcttggacaggacccgctgttcgttttccctaaagataagctcgtggaagaa
ggctccaatgtcaccatttgttacgtttccaaaagccatcagaataacatatcctgttat
ttggaaggcgtacggatgcagggagaacagctcgatccaaatgtgtccgtgttcaacttg
aatcatgttgctttcattagggaaaccgggacaaatatctattgtaagccgggccaagga
gacaggataaagggcaccgttctctttgtgtcaaaagtcctcaaggagcccaaggacttt
tcttgtgaaacccaggacctcacgacattgaactgtacttgggatccggggagtgacacc
ggcttgctcaaacagctttcccagagctacgctttatttgaatcattttccgggaaaaag
accctttgtaaacacaaaagctggtgtctttggcaagtggctccagagtcccaagacatg
tataacttcacactcacggctgaaaactacttacgaaagagaagtgttcaccttcttttt
aacctgactcatcgagtgcacccaatggctcctttcaatgtattatttaaaaatgtaagt
gccacaaatgccaccatgacctggaaggtacactccattgggaagtatcatacactgttg
tgccaagttgaactctacggtgaaggaaaagtgacacaacacaacgtttccgtcaaggtg
gatggtgcgcacctcttcagtggcctggagccggacatggagtacatggcccaggtgcgc
tgtgctaacggcgaccacttctggaaatggagtgagtggacacagcagaacttcaccaca
gccgaagctgctccctcggaggctcctgatgtctggagaaatgtgaaaacagtgcaggga
cgttgtgttgtgactctattctggaagccactatcaaaactgcaggcccacgggaagatt
ctgttctataacatagtcgtagactatctagaccgaacatccgtctccgagctcctctcc
attcctgctccggccaatggtacagaactacctctgagccagtgttcatcccaaatccgc
atcatggctaataacagtgtgggcacttcccctgcttcggtcatcgtagtctcccgagag
cctggaaacgaagaagttgaagaagaaagagttaaaggcacggaggatggattccctctg
tcttggaaaccccaacccagacacgtcacaggctaccttgtggagtggtgtgagcatccc
caggacccgccctgtgatctccagtggaaaaacctgggtcccaatgtcacaagcacagtt
gtgagctcagatgctttcagaccaggggttcgatacaacttcagaatttatggaatttct
acagaacgggttccctatttattagcgagaaaaacaggatactcccaggaactggctcct
tcagacaaccctcaagtggttatgactaacctgacctcccactccttcactctgagttgg
aagaattactccactgaatcccagcccagttttatacaagggtaccacatctacctgaaa
tccaaggcggggtggtgccactcaggatctgagaaggccgttctttcagatgatgcagca
gtgtgttgcaaatacaaaattgacaacccagaacaaaagacatttgtcgtggaaaaccta
cagccggaatccttctatgagtttttggtcaccccgtacaccagtgttggcgaaggcccc
catgatgctttcgcaaaggtcacaactcctgatgaatactcccctacactgatacgtatc
atactccctatggttttctgcattttgctcatcatgatcacatgctacttgaaaagtcag
tggatgaaggagaagtgttatcctgacattccagatccttacaagagcagtgttctgtca
ttaataaaatccaaggagaatcctcacctaacaataatgaatatcaaggactgcgttccc
gactctattgaagttctaaacaagcaggaaggcactaggaagtcactcacggaaactgag
tctaccaagcccacctacctttacctccttccaacagagaagagatactccagccctgga
ccctgcatctgttttgagaactttacctataatcaggcagcttctgactctgcttcttgt
ggccatgtcccagcaccccctaaagccccaccaagtcagctgggactgttgacatcacct
gaaaatttactaaaggcactagaaaaaaactacatgaactccctgggagaaattccagct
ggagaaactagtctaaattatgtgtcccagttggcttcacccatgtctggagacaagtcc
aatctccccataaatccaccagagccagcactctgttcagaatataaaatgcagatggcc
atacccttgggtcttgcctctcctccctcgagtgggagtagcagcctctcttccgttacc
cttttagatgaaggtgaacactaccactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141177
Entry
111141177         CDS       T05871                                 

Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141177
   04151 PI3K-Akt signaling pathway
    111141177
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111141177
   04060 Cytokine-cytokine receptor interaction
    111141177
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111141177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111141177
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111141177
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Interfer-bind
Other DBs
NCBI-GeneID: 111141177
NCBI-ProteinID: XP_022349260
UniProt: A0A2Y9ITJ7
LinkDB
Position
Unknown
AA seq 625 aa
MKESVASTVVFLLLLFLNTGLLNGQSPPGKPVISKCRSPEKETFTCWWKPGEDGGLPTNY
TLTYHKEGETTTHECPDYITSGPNSCYFNKKHTSIWTMYIITINATNQMGSSSSDPRYVD
VTYIVEPDPPVNLTLELKQPEDKKTYLWMKWYPPTLVDVRSGWLTLQYEIRLKPEKATEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDVTMKDTIVWIF
VAVLSAVICLIMVAAVALKGHSMVTCILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPISDCEDLLVEFLEVDDSEDQQLMPTHSKEHPGQDNKPTSLDPDSDSGRGSCDSPSLL
SKKCEEARANPSTFNTPEGIEKPENPQTKVTRSQDAQSARLEGKIPYFPADGSKSSTWPL
PQPPSQHSPRSSYHNIADMCKLALGVTGTSAILLDKTDTQALRSSKTTKTGGEEKAAEQK
EVESFHSKTDQGTAWLLPQEKTPFISVKPLDYVEIHKVNKDGALSLLPKQKENSHQTEKS
GTCEGSKEYAKVSRVMDNNILVLVQDPRAQNLATFEEPAKEAPPSLQQNPAREDLASFSS
APSSCGLQLGGLDYLDPMCFMHSFQ
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaaggaaagtgtggcatccaccgttgttttccttttgctactttttctcaacaccggt
cttctgaatggacaatcacctcctggaaaacctgtgatctctaaatgtcgttctcctgaa
aaggaaacattcacctgctggtggaaacctggggaagatggaggacttcccactaattac
acgctgacgtatcacaaggaaggagaaacaactacacatgaatgtccagattacataacc
agtggccccaattcctgttacttcaacaagaagcacacctccatatggacgatgtacatc
atcacaataaatgccacaaaccagatgggaagcagttcctcggatccacgttatgtggac
gtgacttacatagttgaaccagaccctcctgtgaacctaactttggaattaaaacagcca
gaagacaaaaaaacatacctgtggatgaaatggtacccacccaccctggttgatgttaga
tctggttggctcacactccagtatgaaattcggttaaaacccgagaaagctactgagtgg
gagactcattttgctggacagcagactcagtttaagattctcagcttatacccaggacag
aaataccttgtccaggttcgctgcaagccagaccatggattctggagtgagtggagccca
gagagctctatccagatacctaatgacgtcaccatgaaagataccattgtgtggatcttt
gtggccgttctctccgcagtcatctgtctgattatggtcgcagccgtggctctgaaaggc
catagcatggtcacctgcatccttccaccagttcctgggccaaaaataaagggatttgat
actcatctgctggagaagggcaagtctgaagaactgctgagtgccctggggtgccaagac
ttccctcccatttccgactgtgaggacttgctggtggagtttttggaagtggatgacagc
gaggaccagcagctgatgccgacccattcaaaagaacacccggggcaagataataagccc
acatccctggatccagacagtgactctggccgaggcagctgcgacagcccttcccttttg
tctaaaaagtgtgaggaagcccgggcaaatccctccacatttaacactcctgagggcatc
gagaagccagagaatccccaaacaaaggttacccgcagtcaggacgcccagagcgcacgc
ttagaaggcaaaatcccctatttccctgctgacggctccaaatcttcaacatggccttta
ccacaaccccctagccaacacagccccagatcttcttaccacaacatcgctgacatgtgt
aagctggccctgggcgtgacggggacatcagccatcttgttggacaaaacagacacacaa
gctttaagatcttcaaaaaccaccaagactggaggggaggaaaaggcagctgagcagaag
gaagtggaaagcttccattccaagactgaccaaggcacagcatggctgttgccccaggag
aaaaccccttttatctctgtgaaacccttggattacgtggagattcacaaggttaacaaa
gacggagcactatcactgctcccaaaacagaaagagaacagccaccagacagagaagtcc
ggtacttgtgaaggcagtaaggagtatgccaaggtgtcccgggtgatggataacaacatc
ctggtattggtgcaggatccgcgagctcagaacctggctacttttgaagaaccagccaag
gaggctccaccatctcttcagcagaatccagccagagaagacctggcctccttctcctca
gccccaagcagctgtggactccagctgggtgggttggattacctggatcccatgtgtttt
atgcactccttccagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141253
Entry
111141253         CDS       T05871                                 

Definition
(RefSeq) interleukin-7 receptor subunit alpha isoform X1
  KO
K05072  interleukin 7 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04068  FoxO signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
elk05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141253
   04068 FoxO signaling pathway
    111141253
   04151 PI3K-Akt signaling pathway
    111141253
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141253
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141253
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141253
  09163 Immune disease
   05340 Primary immunodeficiency
    111141253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111141253
   04090 CD molecules [BR:elk04090]
    111141253
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111141253
CD molecules [BR:elk04090]
 Proteins
  111141253
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111141253
NCBI-ProteinID: XP_022349406
UniProt: A0A2Y9IMJ4
LinkDB
Position
Unknown
AA seq 457 aa
MMILGTAFGMVFYLLQAVSGESGYAQNGEFEDAELDDYSFSCYSQLEVDGTQHLLTCAFD
DPDVNITNLEFEICGALLNIKCLAFDKLHEMYFIKTKKFLLIGDSLIHVKLGGKNITSKK
LNIVKIVKPEAPFDIRVIYREGANDFLVTFNTSHSQKKYVKELMHEVAYRQEKNENDWMH
VNISSTKLTLLQRKLQPDAMYEIKVRSIPNANYFQGFWSEWSPTFHFRTPEITGRMDPVL
LTISILSFFFVALMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPES
FLDCQIHKVDGIQARDEAESFLQDTSPPQLDETEKQRLRGGMQGPTWPSEHAVITPKTFR
GDSPFGSLAGSISMCEALVQPSSRSPDCKEGGKNGPHMYQGLLLGSGTTNSTMPTPFPFQ
PGILTLNPAVRGQPGLTSLGSSQEEAYVTMSSFYQNQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatgattctgggtacagcttttggtatggttttctatttacttcaagctgtttctgga
gaaagtggctatgcacagaatggagagtttgaagatgccgaactggatgactattcattc
tcttgctatagtcagttggaagtggatggaacccagcacttgctgacctgtgcttttgat
gaccccgacgtcaatatcaccaatctggaatttgaaatatgtggagcccttttgaatata
aaatgcctggcttttgataaactgcatgagatgtatttcattaagacaaagaaattctta
ctcattggagacagcctaatacatgtgaaacttggaggaaaaaacataacttccaagaaa
ttgaacatagtcaaaatagttaaacctgaggctccttttgacataagagtcatctatcgt
gagggagcaaatgactttctggtgacatttaacacatctcattcacagaagaagtatgtg
aaagaattaatgcatgaggtggcctatcgccaggaaaaaaatgaaaatgactggatgcat
gtgaacatatccagtacaaagctgacactcctacagagaaaactacaacctgatgcaatg
tatgagattaaagtccggtccatccctaatgccaactattttcaaggcttctggagtgaa
tggagtccaaccttccacttcagaacaccagagatcacagggaggatggatcctgtttta
ctaactattagcattctgagtttcttctttgtggctctgatggtcatcttggcctgcgca
ttatggaaaaaaagaattaaacccattgtgtggcccagcctccccgatcataagaagact
ctggaacaactgtgcaagaaacccaaaaagaatttgaatgtgagtttcaaccctgaaagc
ttcctggactgccagattcataaggtggatggcattcaagctagagatgaagcagagagc
tttctgcaagacacttctcctccacaactcgatgagactgaaaagcaaaggcttcgaggc
ggtatgcagggccccacctggccatcagagcatgcagtcatcaccccaaaaaccttcaga
ggagattcaccctttggaagcctggctggaagcatcagtatgtgtgaggcccttgtgcaa
ccttcttccaggtccccagactgcaaggaaggtggcaagaatgggcctcatatgtaccag
ggcctgctgcttgggtctggaactacaaatagcaccatgcccactccatttcctttccag
ccaggaatcctgacactgaacccagctgtccggggacagcccgggctcacttccttggga
tcaagtcaggaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143098
Entry
111143098         CDS       T05871                                 

Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143098
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111143098
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111143098
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143098
  09163 Immune disease
   05321 Inflammatory bowel disease
    111143098
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111143098
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111143098
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 111143098
NCBI-ProteinID: XP_022352278
UniProt: A0A2Y9IUS4
LinkDB
Position
Unknown
AA seq 862 aa
MAHTVGGCSLALIFIIVLLLVKANIDACKRGDVTVEPSRVISLGSAVNISCSLKPEQGCS
RYPSFNKLILYRFKRRINFLHGHFLSSQVTGLPLGTTVFFCRLACSKNKELQICGAEILV
GVVPEQPQNLSCIQKGERGTVTCTWDRGRDTHLYTAYTLQLSGPKNLTWQKQCNGHYCDH
LDLGVSLTPEMPESSYIAKVTANNSLGSASSFPSTFTFLDIVRPLPPWDIRIKCVNASVS
RCILRWRDEGLVLLNRLRYRPNSSGPWEMVSTTNAKGRHDLLDLKPFTEYEFQISSKLHL
CKGSWSDWSESLRTQTPEEEPSGTLDVWYMKQHIDYSRQQISLFWKNMTVSEAQGKILHY
RVTLQEVAGGKVTLQNITEHTSWTWVIPRTGNWVLTVSAANSKGSSLPTRINITDLCGTG
LLAPRQVSANSKGVDNIMVTWEPPGKAAPAVQEYVVEWRELRPRGGTQPRLNWLRCTPLN
VSALISENIKPYSCYEISVCAISGDQRGCSSIRGNSKHIPPRSGPHINAISEEKGSMVIS
WNEIPAQEQMGCLLHYRIYWKEQDSNSQPQVCEIPYRVSLNSHSIDNLQPRVTYVLWMTA
LTAAGESPPGNEREFCLQGKASWSVFVAPSICVAVVIVGIFSMRYFRQKVFVLLLALRPQ
WCSKEIPDPANSTWAKKYPIVEEKQQLPLDRLLTDRPNPEEPETLVITEVLHQVTPLFRH
PYHPNWPVKGQGVQGHYTSEEDTQYSASSLPPSKALIAETGQLVDLYKMLGSRGPDSKPG
HLASPLTVLPVDYLPTHEGYLPSNIEYLPSHEVPITDPMEELEPQHIPLSIFPSSSLHPL
TFSCDKKLTLDRLKMGCNSLML
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcacatacagttggaggttgctcactggcacttatttttatcattgtgttgttgttg
gttaaagcaaatatagatgcatgcaagagaggagatgtgactgtggagccttcccgtgta
atttcacttggatcagctgtcaatatttcatgctctttgaagcccgaacaaggctgctca
cgatatcccagttttaacaagttaatcctctacaggttcaaaagaagaatcaattttctg
catggtcacttcctcagttctcaagtcacaggtcttcctctgggcacaacagtgtttttc
tgcagactggcctgtagcaaaaacaaggaattacaaatatgtggggcagagatcttggtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggtgaacgtgggact
gtgacctgcacctgggacagaggacgagacacccatctatatactgcgtatactttacag
ttaagtggaccaaaaaatttaacttggcagaagcaatgtaatggtcattattgtgaccat
ttggaccttggagtcagtctaacccctgaaatgcctgaatccagctacatagccaaggtt
actgctaacaatagccttggaagtgcttcatcatttccatccacatttacattcttggac
atagtgagacctcttcccccgtgggacatcagaatcaaatgtgtaaacgcttctgtgagc
agatgtatccttcggtggagagatgaggggctggtgctgcttaaccgactcagataccgg
cccaacagcagtgggccctgggaaatggtcagtactacaaatgccaaaggaagacatgat
ttgctggatctgaagccattcacagagtatgaatttcagatttcctctaagctacatcta
tgtaaaggtagttggagtgattggagtgaatcgttgagaacacaaacaccagaagaagag
ccttctgggacattggatgtctggtacatgaaacagcacatcgactacagtagacaacag
atttctcttttctggaagaatatgactgtatctgaggcacaaggaaaaattctccactat
cgcgtgaccttgcaggaagtggccggggggaaagtcacactacagaacatcacagaacac
acctcctggacgtgggtcattcccagaactggaaattgggttttgactgtgtctgcagct
aactcaaaaggcagttccctgcccactcgtattaacataacggacctgtgtgggacaggg
ttgctggctcctcgccaggtctctgcaaattcgaagggtgtggacaacattatggtgacg
tgggagcctcctgggaaagctgcacctgctgtccaggagtatgtggtggaatggagggag
ctccgtcctaggggtggcacacagccccgtctaaactggctgcggtgtaccccactcaac
gtgtcggctctgatttcagagaacataaaaccctatagctgttatgaaatcagcgtgtgt
gcgatatccggggaccagagagggtgcagctccatccggggtaactcgaagcacatacca
ccacggagtggcccccacattaatgccatctcagaggaaaaggggagtatggtaatttca
tggaacgaaattccagcccaggagcaaatgggctgcctcctccattacaggatatactgg
aaggaacaggactccaattcccagcctcaagtgtgcgaaattccctacagggtatcccta
aattcacattcaatagacaatctgcagcccagagtgacatatgtcctgtggatgacagct
ctgacagcggctggggaaagccccccaggaaacgagagggagttttgtctgcaaggtaaa
gccagttggagtgtgtttgtggcaccaagcatttgtgttgctgtcgtcatagtgggcatt
ttctcaatgcgttacttccggcaaaaggtatttgttctccttttggccctcagacctcag
tggtgtagtaaagaaattccagacccagcgaacagcacctgggccaagaaataccccatc
gtggaggagaagcagcagctgcccttggacaggctcctgacagaccggcccaatcctgaa
gaacctgagaccctggtcatcactgaagtccttcatcaagtaaccccactcttcagacat
ccctatcaccccaactggccagtcaaggggcaaggagtccaaggtcactatacctctgag
gaagacacacagtacagtgcttcaagcctaccaccttcaaaagctctcatagcagagaca
ggacaactagtggatctgtacaagatgctggggagcaggggccctgactcaaagccagga
cacctagcgagccccttgacagttctcccagtggactaccttcccacccatgagggatac
ttaccctccaacatagagtatctcccttcacatgaggttcctataactgaccctatggaa
gaactagagcctcaacacatacctctttccattttcccttcaagttcccttcacccactc
accttctcttgtgacaagaagctgactctggatcggttaaagatgggatgcaactccctc
atgctgtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143244
Entry
111143244         CDS       T05871                                 

Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143244
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111143244
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111143244
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143244
  09163 Immune disease
   05321 Inflammatory bowel disease
    111143244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111143244
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111143244
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL12p40_C Lep_receptor_Ig
Other DBs
NCBI-GeneID: 111143244
NCBI-ProteinID: XP_022352561
UniProt: A0A2Y9IW17
LinkDB
Position
Unknown
AA seq 631 aa
MNQVTIQWDVVIALYIFFNWCHGGITNINCSGHIWVEPATVFKMGMNISIYCQAAIKNCQ
PRKLYFYKNGIKERFQITRINKTTAQLWYNNFLEPHASMYCTAKCPGYFQETLICGKDIF
SGYPPDVPDKVTCVIYEYSGNMTCTWNSGKPTYIDTKYVVYVKSLETEEEQQYLSSSCIN
ISTDSLQGGKKYLVWVQAANALGMEKSKQLQINLDDIVIPSASIISRAEDINTAVPKTII
HWHSQTTFEKVFCEMRYRTTTNQTWKVKEFDANFTYEQQSEFYLESDTNYIFQVRCQETG
KKYWQPWSSPFSHKTPETVPQVTQKSFQHDTQNSKHLTASIFKGRLTSDNRQQDTGLLSG
MVFFAVMLSILSLIGIFNRSLRTGIKRRLLLLIPKWLHEDIPNMENSNVVKMLQEKSEFM
NNNSSEQVLYVDPVITEIEIFLPEENKPMDYKTEKKTESLEARDCLQKSLLTNTTAVYIP
GLSTGYKPQISNFLTGGNHLSKNDDTSSSTLKPMADSLDLGENARFKKYPNFAFSVSSMN
SLSNTLFFEELSLILNQGECSPLDMQNSVEGETTMLLENASPNETIPEQTLLPDEFVSCL
GVMNEELPSINSYFPQNILENHFNTISLLEK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggatgtggttatagctctttacatattcttcaattgg
tgtcacggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
gtttttaagatgggtatgaatatctctatatactgtcaagcagcaattaagaactgccaa
ccaaggaaactttatttttataaaaatggcatcaaagaaagatttcagatcacaagaatt
aacaaaacgacagctcagctttggtataacaactttttggaaccacacgcctctatgtac
tgcactgctaaatgtcctggatattttcaagagacactgatatgtggaaaagacattttt
tctggatatccaccagatgttcctgacaaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgtacctggaattctgggaagcccacctacatagatacaaagtatgtggtg
tatgtgaagagtttagagacagaagaagagcaacaatatctttcttcaagttgtattaac
atctctactgattcattgcaaggtggcaagaaatatttggtttgggtccaagctgcaaat
gcactgggtatggagaagtcaaaacaactgcaaattaatctggatgatatagtgatacct
tctgcatccatcatttccagggctgaggatataaatactgcagtgcccaagaccataatt
cactggcatagtcaaacaacatttgaaaaggttttctgtgaaatgagatacaggactaca
acaaaccaaacttggaaggtcaaggaatttgatgccaattttacatatgagcaacagtca
gaattctacttggagtcagacactaattatatatttcaagtgagatgccaagaaacaggt
aaaaagtactggcaaccctggagttcccccttttctcacaaaacacctgaaacagttccc
caggtcacacagaaatcattccaacatgatactcagaattctaagcatctaactgcttcc
atctttaaaggacgtcttacttctgacaaccggcaacaagacactggacttttatcagga
atggttttctttgctgttatgttatcaattctttctttgattgggatatttaacagatca
ctcagaactgggattaaaagaagactcttattgctaataccaaagtggcttcatgaagat
attcccaatatggaaaacagtaatgttgtaaaaatgctacaggaaaaaagtgaatttatg
aataataattccagtgagcaggtcctatatgttgatccggtgattacagagatagaaatc
tttctcccagaagaaaacaagcccatggactacaagacagaaaagaaaacagaatccctg
gaggccagagactgcctgcagaaatcactactcaccaacactacagctgtgtatattcct
ggtctcagcactgggtataaaccccagatttcaaattttctcactgggggaaaccatctc
agcaaaaatgatgacacatcttcatcaactctcaaaccaatggctgattccttagacctg
ggggaaaatgccagatttaaaaaataccctaattttgctttttctgtctcaagtatgaat
tcgctaagcaacacactattttttgaagaattaagcctcattttaaatcaaggagaatgc
agccctctggacatgcaaaactcagttgagggagaaactaccatgcttttggaaaatgct
tcacccaatgaaactattccagaacagaccctgttgcccgatgaatttgtttcctgtttg
ggggttatgaatgaggagttgccatctattaattcttattttccgcaaaatattttggaa
aaccacttcaatacgatttcactcttggaaaagtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143310
Entry
111143310         CDS       T05871                                 

Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04080  Neuroactive ligand-receptor interaction
elk04152  AMPK signaling pathway
elk04630  JAK-STAT signaling pathway
elk04920  Adipocytokine signaling pathway
elk04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143310
   04152 AMPK signaling pathway
    111143310
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111143310
   04060 Cytokine-cytokine receptor interaction
    111143310
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111143310
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111143310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111143310
   04090 CD molecules [BR:elk04090]
    111143310
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111143310
CD molecules [BR:elk04090]
 Proteins
  111143310
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 111143310
NCBI-ProteinID: XP_022352670
UniProt: A0A2Y9J3M5
LinkDB
Position
Unknown
AA seq 1166 aa
MTCQKFCVALLHWEFIYLTTALNLAYPITPWRFKLSCMPPNTTYDFLLPTGISKNTSNLN
EHYEAVVKAKLNLSTTYFSNLSSKTTFYCCFWSKEDKNCSVHADNIDGKDFVSTVNSLVF
QQIGANWNIQCWMKEDLKLFICYMESLFKNPFKTYDLKVHLLYVLPEVLEESPPVPQKSS
FQIVQCNCSVHDSCECHVPVPTAKLNHTLLLYLKIKSGGINFQSPLMSVQPINVVKPDPP
LDLHMEITDAGHLRISWSSPTLVPFQLQYQVKYSENSSINMRKADEIVSTTSLLIDSVLP
GSSYEVQVRGKRLDGPGIWGDWSTPLIFTTQDVVYFPPKILTSVGSNVSFHCIYKSENKI
VSSKKIVWWLNLAEKIPPRQYAVVGDRVSKVTFPHLNATKPRGKFTYDAVYCCNQQECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSANAIQSLMGSTLQLRYHRSSLYCSDVPSIH
PMSEPKDCHLQRDGFYECIFQPIFLLSGYTMWIKINHSLGSLDSPPTCVVPDSVVKPLPP
SSVKAEITVEIGLLKISWEKPVFPENNLKFQIRYGLNGKEVQWKMYEVYEAKSKSASVLV
PDLCAVYAVQVRCRRLDGLGYWSNWSSPAYTVVMDIKVPTRGPEFWRIINEDTTKKERNV
TLLWKPLMKNDSLCSVRKYVVKHHTSRNGTWSEDVGNHTKSTFLWTEQAHSVTVLAVNSI
GASFVNFNLTLSWLMSKVNSVQSLSAYPLNSSCVLLSWTLLPSDYSLMYFVTEWKILNED
SEVKWLRIPPSVKKYYIHDHFIPIEKYQFSLYPVFMEGVGKPKIINSFPQDDIEKHQHDA
GLYVIVPIIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTESVIFGPLLLEPETISEDISVDTSWKNKDEMVPATMVSVLLTTPDLEKGSVCTHDQH
SSANFSELESTVIAREDENRRQPSVRYATLLGSSKSSEIDDEQGLINSSVSKCFSSKDSQ
PKGSFSNSSWEIETQAFFILSDQHPNIISPHLPFSEGLDELLKLEGNFPEENNGERSVYY
LGVTAIKKRETGVFLTDQSQVLCPFPAHCLFTDIRILQDSCSHLVENNFNLETSGQKTFV
SYMPQFQICSTQTQKIMENKMCDLTV
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgacttgtcaaaaattctgtgtggctttgttacattgggaatttatttatttgacaact
gcacttaacttggcatatccaattactccctggagatttaagctgtcttgcatgccacca
aatacaacttacgacttcctcttgccaactggaatctccaagaacacttccaatctgaat
gaacattatgaggcagttgtcaaagctaaattgaatttgagtactacctacttttctaac
ttatcttccaaaacaactttctactgttgcttttggagcaaggaagataaaaactgttct
gtacatgcagacaacattgatgggaaggactttgtttcaacagtgaattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgttatatggagtcattatttaagaatcctttcaagacttatgaccttaaggtccat
cttttatatgttctgcctgaagtgttagaagagtcacctccggtcccccagaaaagcagt
tttcagattgtccagtgcaactgcagtgttcacgacagctgtgaatgccacgtgcctgtg
cccacagccaaactcaaccacactctccttctgtatctgaaaatcaagtctggtggaata
aacttccagtcacctctaatgtcagttcagcccataaatgttgtgaagcctgatccccca
ttagatttacatatggaaatcacagatgctggccacttgaggatttcttggtccagccca
acattggtgccatttcaacttcaatatcaagtgaaatattcagagaattcttcaataaac
atgagaaaagctgatgagattgtctcaactacatctctgctgatagacagtgtgctccct
gggtcttcatacgaggttcaagtgcggggcaagagactggatggcccaggaatctggggt
gactggagcacccctcttatctttaccacacaagatgtcgtatactttccgcctaaaatt
ctgacaagtgttgggtctaacgtttcttttcactgcatttataaaagtgaaaacaagatt
gtttcctcaaaaaagattgtttggtggctgaatttggcggagaaaattcctccgaggcag
tatgccgtggtgggtgaccgcgttagcaaagtcacgtttccacatttgaatgcaaccaag
cctcgtgggaagttcacctacgatgccgtgtactgctgcaaccagcaggaatgccaccat
cgctatgcggaactatacgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcagccaatgcaatccaatcactcatgggaagt
actttgcagttgaggtatcacaggagcagcctttactgttctgatgttccatctattcat
cccatgtctgaacccaaagattgccatttgcagagagatggtttttatgaatgcatattt
cagccaatctttctcttatccggctatacaatgtggattaaaatcaatcactctttgggt
tcacttgactctccaccaacgtgtgtcgttcctgattccgtggtgaaaccactgcctcca
tccagtgtgaaagcagaaattactgtagaaattgggttattgaaaatatcttgggaaaag
ccagtctttccagagaataatcttaagttccagattcgctacggcttaaatggaaaagaa
gtacagtggaagatgtacgaggtgtacgaggcaaaatcaaagtcggccagtgtcctggtg
ccagacctgtgtgccgtctacgcggttcaggtgcgctgccggaggctggatgggctgggc
tactggagtaactggagcagtcccgcctacaccgttgtcatggatataaaagttcctacc
agaggacctgaattttggagaatcataaatgaagacaccactaaaaaggagaggaatgtt
actttactctggaagcctctgatgaaaaatgactcattgtgcagtgtgagaaaatatgta
gtaaaacatcatacttcccgcaatggaacatggtcagaagatgtgggaaatcacactaaa
tccactttcctgtggacagaacaagcacattctgttacagttctggctgtcaattcaatt
ggtgcttcttttgtgaattttaatttaaccttatcatggcttatgagcaaagtaaattcc
gttcagtcgctcagtgcttatcctttaaacagcagttgtgtgcttctgtcctggacgcta
ttacctagtgactactctctgatgtattttgttactgagtggaaaattcttaatgaagac
agtgaagttaaatggcttaggatccctccatcagttaagaagtattatatccacgatcat
tttatccccattgagaaatatcaatttagtctttacccagtatttatggaaggagtaggg
aaaccgaagataattaatagtttcccccaagatgatattgaaaaacaccagcatgatgca
ggtctatatgtaattgtgccaataattatttcctcttcaatcttactgcttggaacactg
ttaatatcacaccaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaac
tgttcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatc
aagcatacagaatcagtgatatttggtcctcttcttttggagcctgaaaccatttcagaa
gatatcagtgttgacacatcatggaagaataaagatgagatggtaccagccactatggtc
tctgtacttttgacaactccggatcttgagaagggttctgtttgtacccatgaccagcac
agcagtgctaacttctctgagctggagagcaccgtgatagcccgtgaggatgaaaacagg
aggcagccctctgttagatacgccaccctcctcggcagctcgaaatcaagtgaaattgat
gacgagcaggggcttataaacagctcagtcagcaaatgcttctctagcaaagattcccaa
ccaaagggttctttttccaacagctcatgggagatagaaacccaggcattttttatatta
tcagatcagcatcccaatataatttcgccacaccttccattctcagaaggattggacgaa
cttttgaaactcgagggaaatttccctgaagaaaataatggtgaaaggtctgtctattat
ttaggggtcaccgcaatcaaaaaaagggagactggtgtgtttttgactgaccagtcccaa
gtgttgtgtccattcccagcccactgtttattcactgacatcagaatcctccaggacagt
tgttcacaccttgtagaaaataacttcaatttagaaacttctggtcagaagacttttgta
tcttacatgcctcagtttcagatttgttccactcagactcagaaaataatggaaaacaaa
atgtgtgacctaactgtctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143352
Entry
111143352         CDS       T05871                                 

Definition
(RefSeq) granulocyte colony-stimulating factor receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143352
   04151 PI3K-Akt signaling pathway
    111143352
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111143352
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111143352
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111143352
   04090 CD molecules [BR:elk04090]
    111143352
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111143352
CD molecules [BR:elk04090]
 Proteins
  111143352
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind ObR_Ig fn3_2
Other DBs
NCBI-GeneID: 111143352
NCBI-ProteinID: XP_022352744
UniProt: A0A2Y9IZA9
LinkDB
Position
Unknown
AA seq 839 aa
MAGLGTWSLTVAALIALLLPRSLEECGRISLPTPTVHLGDPITASCIISPNCSHLDPESQ
ILWKLGTELQPGKRQRRLADGRQESTITVPHLNSPRVLLSCCVRWGTSLQILDQAEVQAG
YPPTAPHDLSCLMNLTTNSLICRWEPGPDTHLSTHFTLKSFKSRGNCQTQEDSILDCVPN
NGQNHCSIPRRHLLLYQNMGIWVEAENALGTNKSPQLCLIPMDVVKLEPPTLWALAPSPE
VAPPQPGCLLLRWEPWKPSLYIEQKCELRHQPQLGETSWVLVGPLLSQTLQYELCGLLPS
TAYALQMRCTRWPLPGQWSDWSPSLMLTTAQRAPIVRLDTWWRQRPLDPRTVAVQLFWKP
MPLDKYSGQIQGYLVRAPNQTEAVPPFCNTTELSCTFHLPSEVRTVVLVAYNTAGTSNPS
PVVFLESTGPPLARLHTEARDPHSLWVGWEPPSPQPRGYVIEWGLGPPSPSGSNKSWKME
HNGSISGMLLQENIRPFQLYEITVTPLYHDTVGPSQHIYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPQAPELGKSPLTHYTIFWTNAQDQSFSTVLNASSHGLVLHGLEPASLYHVHL
MATSKAGAANSTSLTLMTLALEESELHVLLGLFGFLLLFTCLGGAARFCCKPSRKNPLWP
SVPDPAHSSLGSWVPTIMVEETFQLPSLRDPGMPPITKITVLEEEEKKPGPWESNDSSGT
CGLPTLVQAYVLQGDPRAPSNQPRPPSITSDQVLYGKVLGSPTGPGPGHYLRCDSTQPLL
GSLSPSPKFYENLWFQTTPLGSPEPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGV
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggcagggctaggaacctggagcctgaccgtggctgccctgattgccctgctgctccct
agaagcctggaggaatgtgggcgcatcagcctccccacccccactgtccacctgggggat
cccatcacagcctcctgcatcatcagcccgaactgcagccacctggaccctgagtcacag
attctgtggaaactgggaacagagcttcaacctggaaagaggcagcgacgtctggcagat
ggaaggcaggaatccaccatcaccgtgccccacctcaacagcccccgggtccttctctcc
tgctgcgtgcgctggggcaccagcttacagatcctggaccaggctgaggtgcaggcaggc
taccctcccaccgctccccacgacctgtcctgtctcatgaacctcacaaccaacagcctc
atctgtcggtgggaaccaggacccgacacccacctgtccacccacttcacactcaagagc
ttcaagagccggggaaactgtcagacacaagaggactctatcctcgactgcgtgcctaac
aatgggcagaaccactgctccatcccacgaagacacctcctgttgtaccagaacatgggc
atctgggtggaggctgagaacgccctagggaccaacaagtccccacagctgtgcctcatt
cccatggatgtcgtgaagttggaacccccgacactgtgggccctggcccccagccctgag
gtggccccaccccagccaggctgcttgctgttacgctgggagccatggaagccgagcctg
tacatagaacagaaatgtgagctgcgccaccagccacagcttggagaaaccagctgggtc
ctggtgggtcccctgctctcccagaccctccagtatgagctctgcgggctcctcccatcc
acagcctacgccctgcagatgcgctgtacccgctggcccctgcctggccaatggagcgac
tggagccctagcctgatgctgaccactgcgcaacgggcccccatcgtcagactggacaca
tggtggcgacagaggccattggaccccaggacggtggccgtgcagctgttctggaagcca
atgcccttggacaaatacagcgggcagatccaaggttacctggtcagagctccgaaccag
actgaggcagtccccccattctgcaacaccacggagctaagctgcaccttccacttgccc
tcggaagtccggacagtggtccttgtggcctataacacagccgggacctctaatcccagc
ccagtggtcttcctggagagcacaggcccgcccctggccagactccacaccgaggctcga
gatccccacagcctctgggtgggctgggagccgcccagccctcagcctcggggttatgtg
attgagtggggcctgggtccccccagccccagcggcagcaataagagctggaagatggag
cataacggaagcatttctgggatgctgctgcaggagaacatcagaccctttcagctctat
gagatcactgtgacccccctctaccatgacaccgtgggaccctcccagcacatctatgcc
tactcccaagagatggccccctcccacgccccagagctgcatctaaaacacattggcaag
acctgggcccagctggagtgggtgccccaggcccccgagctggggaagagcccccttacc
cactacaccatcttctggaccaatgctcaagaccagtccttctccactgtcctgaatgcc
tcctcccacggcttggtcctccacggcttggagcctgccagcttgtaccatgtccacctc
atggctaccagcaaggccggggccgccaacagtacgagccttaccctgatgaccttggcc
ctagaggagtctgagctgcatgtcctcctgggcctgtttggtttcctcctcttgttcacc
tgcctcggtggggccgcccggttctgctgcaaacccagcaggaagaatcccctctggcca
agtgtcccagacccggcccacagcagcctgggctcctgggtgccaaccatcatggtggag
gagaccttccagctgcccagccttcgggaccccggcatgccacccatcaccaagatcacg
gtgctggaagaagaagagaagaagccagggccctgggagtccaatgacagctcagggacc
tgtggcctccccaccctggtccaggcctatgtgctccaaggggacccaagagcaccttcc
aaccagccccggcccccatctatcaccagtgaccaggtcctttacgggaaggtgctgggc
agccccacaggcccaggtccagggcattacctccgctgtgactctactcagcccctctta
gggagccttagtcccagccccaagttttatgagaacctctggttccagaccacccccctt
ggaagcccagagcccctcgtccccaaccaggaggatgactgtgtcttcgggccactgctt
gacttccccctcctgcaagggctccaggtccatggggtagaggggctggggggcgtctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143522
Entry
111143522         CDS       T05871                                 

Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143522
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111143522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111143522
   04090 CD molecules [BR:elk04090]
    111143522
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111143522
CD molecules [BR:elk04090]
 Proteins
  111143522
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 111143522
NCBI-ProteinID: XP_022353044
UniProt: A0A2Y9J052
LinkDB
Position
Unknown
AA seq 678 aa
MPSWALLAVTSCLLLAPQNLAQVTNQDASFLASDSEPLNCFSRTFEDLTCFWDEEEAAPN
GTYQLLYAYPGEKPRACPLSFKSVPPFGTRYVCQFPAQDEVRLFFPLHLWVKNVFLNQTL
TQRVLFVDSVGLPAPPDIIKASGGIQPGELQISWETPAPEISDFLRHELRYGPKDPRNSI
GPTVMQLLPTETCCPVLQRLNLVPALHQPPCAQPMMPQQDGPEQTSPTREASSLTVRSGS
CLISGLKPGQSYWLQLRSQPDGVSLLGSWGSWSLPATVDLPGDAVEIGLQCFTLNLKNVT
CQWQQQDHASSQGFFFHSRARCCPRDRDPIWEKCEEEKNPGLQASQFSRCHFKSQNDSII
HILVEVTTAQGAVHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLEVEWQHPSSWGAQETC
YQLRYTGEGHQDWKVLEPPLGAQRETLELRPRSRYRLQLRARLHGPTYQGPWSAWSEPVR
AETTSDSAWISLVTALLVVLGLSALLGLLLLRWQFPAHYRSLKHALWPSLPDLHRVLGQY
LRDTAALSPPKAAVSDAFEEVEPSPLEILPKSSEKISMALCSSQAQMDYRGLPPSCLGTM
PLCVCPPMAESGSYCTTHIANHSYLPLSCWQGPLSPYPGQIQTGQTSFPNLPTHPIPSTQ
TSQTSRPSPSVCPHSWAP
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggcggtcacctcctgcctcctcctggccccccaaaatctg
gcacaagtcaccaaccaagatgcctcctttctggcctcggattcagagcccctgaactgt
ttctctcgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcacccaat
ggaacataccagctgctgtatgcctacccaggggagaagccccgtgcctgcccactgagt
ttcaagagcgtgcccccctttggaacccgatacgtgtgtcagtttccagcccaggatgaa
gttcgcctcttctttccgctgcacctctgggtgaagaacgtgtttctgaaccagactctg
acccagcgtgtgctctttgtggatagtgtaggcttgccagctcccccagatatcattaag
gcttcaggcgggatccaaccaggggaacttcagatcagctgggagaccccagctcctgaa
atcagtgatttcctgaggcatgaacttcgctatggccccaaggatcccaggaattccatt
ggtcccacagtcatgcagctgctgcccacagaaacctgctgtccagttctgcagagacta
aacctggtcccagctctgcaccagcctccatgtgctcagcccatgatgccccaacaggat
ggaccagagcagacgtccccaactagagaagcttcatctctaacagtgaggagtggaagc
tgcctcatctcagggctcaagcctggtcaatcctactggctgcagctgcgcagccaacct
gatggggtctccctccttggttcctggggttcctggtccctccctgcaactgtggacctg
cctggagatgcagtggaaattggactgcagtgctttaccttgaacctgaagaatgttacc
tgtcagtggcagcaacaggaccatgctagctcccaaggcttcttcttccacagcagggct
cggtgctgccccagagacagggaccccatctgggagaagtgtgaagaggagaaaaatcca
ggattacaggcctcccagttctcccgctgccacttcaagtcacaaaacgacagcattatt
cacatccttgtggaggtgaccacagcccagggtgctgttcacagctacctgggctcccct
ttctggatccaccaggctgtgctcatccccactccaaacttgcactggagggaggtctcc
agtgggcagctggaagtggaatggcaacacccatcatcctggggagcccaagagacctgc
tatcagctccgctacacaggagaaggccatcaagactggaaggtgctggagccgcctctc
ggggcccagcgggagaccttggagctgcgcccgcgctctcgctaccgcctacagctgcgc
gccaggctccacggccccacctaccaagggccctggagcgcctggtcagagccggtgcga
gcagagaccacctccgactccgcttggatctccttggtgaccgctctgctcgtggtgctg
ggcctcagcgccctcctgggcctgctgctgctgaggtggcagtttcctgcgcactacagg
agcctgaagcatgccctgtggccctcccttccagacctgcaccgggtcctaggccagtac
cttagggatactgcagcgctgagtccgcccaaggctgcagtctcggatgcttttgaggag
gtggaacccagcccccttgaaattctacccaagtcctcagagaagatctccatggccctg
tgttcctcccaggcccagatggactaccgaggattgcccccttcttgcctggggaccatg
cccctgtgtgtgtgcccacccatggctgagtcggggtcctactgcaccacccacattgcc
aaccattcctacttacctctgagctgctggcagggccctctctccccataccctggacag
atccaaactggccagacctcttttcccaacctccctacccaccccatcccctcaacacaa
acatctcagacctcacgtccatccccctctgtctgtcctcatagttgggctccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111144102
Entry
111144102         CDS       T05871                                 

Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111144102
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111144102
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111144102
   04659 Th17 cell differentiation
    111144102
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144102
  09163 Immune disease
   05321 Inflammatory bowel disease
    111144102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111144102
   04090 CD molecules [BR:elk04090]
    111144102
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111144102
CD molecules [BR:elk04090]
 Proteins
  111144102
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111144102
NCBI-ProteinID: XP_022353939
UniProt: A0A2Y9J2L5
LinkDB
Position
Unknown
AA seq 751 aa
MFRGKDRVAGRSSSGAVSFCVGSMGQLWARLVPLLLLLLRGQGAEACSTSGCCFQDPPYP
DAGAGSASGPRDLNCYRIVSAGYECSWQYEGPMAGVSHFLRCCLRSGRCCYFAAGSATSL
RFSDQDGVAVLQAVTLWVESRAENRTQKSPKITLKLHSAVKYDPPLVGDITVSRSLGQVL
LKWENPARQDGAEVQFRHRTSSSLWELGNCGPQEDAGFESCLCPLRTDAAQEFQLRRRRL
RPAAPGDPGDPWSSWSSPVCIPPEHLPQPTLKFSMEALRPNGRRQVTLHGQLPQVELPEG
CLGSNSGGEVTYRARLHMLSCTCKIKSTMNFQLKKPLDLSGAAYDLAVISQNRFGPGPNQ
TWHIPAQTHTHTEMGALNISVGADGTSMHWPAQARAKTYCIEWQAQDQDRNLTNCTLTPS
QDQDPTGMATYSWSRGSGAMEEEVCYHITIFASPRPEKPISWSTVLSTYHFGGNASGAGR
PQHVSVRKLSQGSVNVDWTPSPLSACPGVLKEYVVRCEDEEGNLVSELPVKATETQVTLD
GLRAGTAYTVRVRADTVTLQGVWSRPQPFSIEAQVSRLFDLSILFVSLGSFVSILLLGVL
GYLCLNRAARYLCPPLPTPCASTVIEFPSNQGKQAWQWTSPADFPEEVSPKEALVVNMSW
EKGEGTDLDTPMHLKEKTQLLRDTPELTLDTELPLEDRRHVQGHLEPQALGPGRQEGLEG
NLAQGAGLSLPLGDLIQTPIISGPSNMDLEA
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgttcaggggcaaggacagggtggctggcagaagttcatctggggctgtgagcttctgc
gtgggctccatgggacagctgtgggccaggctggtccccctccttctgctcctgctccga
gggcaaggcgctgaagcctgcagtaccagtgggtgctgttttcaggacccgccgtatccg
gatgcaggcgcaggctcggcttcaggccccagggacctgaactgctaccggatagtcagt
gctggttatgaatgctcctggcagtatgagggccccatggctggggtcagccacttcctg
aggtgctgcctcaggtccgggcggtgctgctactttgccgcgggctcagccaccagcctg
cggttctctgaccaggacggtgtagctgtgctccaggccgtcacgctctgggtggaatct
cgagctgagaaccggacacagaagtcccctaagatcaccctgaagcttcatagtgcagtt
aaatacgaccctccgctggttggagacatcactgtgtctaggtccttggggcaggtgctc
ttgaagtgggagaacccagcccgccaggacggcgccgaggtgcagttccggcaccggaca
tccagcagcctgtgggagttgggcaactgcggacctcaggaggatgctggcttcgagtcc
tgcctctgccccctgcggacggacgcagcccaggaattccagctccgcaggcggcgactc
aggccagcagccccaggagacccaggagacccctggagcagctggagcagccccgtgtgt
atcccccctgaacatctcccacagcccaccttgaagttctcgatggaggcgctccgcccc
aatgggaggaggcaggtgaccctgcacgggcagctgccccaagttgagcttccagaaggc
tgcctcggatccaactctggcggggaggtgacctaccgcgcccgcctgcacatgctatcc
tgcacgtgtaagatcaagtcgacaatgaactttcagctgaagaaaccgctcgacctctct
ggtgcggcctatgacctggctgtcatctctcagaatcgcttcggccccggccccaaccag
acatggcacattcctgcccaaacccacacccacacagaaatgggggctctgaatatcagt
gtcggagccgatgggacctccatgcactggccagcccaggccagggccaagacgtattgc
attgagtggcaggcccaagaccaggacaggaacctcaccaactgcaccctgactccatcc
caggaccaggaccctacaggaatggcaacctacagctggagcagaggatctggggcaatg
gaggaggaggtatgttaccacatcacgatcttcgcctctccacgcccagagaagcccatc
tcgtggtccacggtcttgtccacctaccacttcgggggcaatgcctccggggcaggacgc
ccacagcacgtgtcggtgaggaagctcagccagggctccgtgaacgtggactggacgccg
tccccgctgagcgcttgcccaggtgtcctgaaggagtacgtcgtgcgctgcgaggatgag
gagggcaacctcgtctctgagctgcctgtgaaggccacagagacccaggtcacccttgat
ggccttcgggctgggacagcctacactgtgcgggttcgagcagacacagtgacgctgcag
ggtgtctggagccggccccagccattcagcatcgaagcccaggtttcccggttgttcgat
ttgtccatactcttcgtgtctctggggagcttcgtcagcatccttctcctgggcgtcctt
gggtacctctgcctgaacagggctgcacgttacctgtgcccgcccctgcccacgccttgt
gccagcactgtgatcgagttccctagcaaccagggaaagcaggcttggcagtggacaagc
ccagcagacttcccggaggaggtgtccccaaaagaggccttggtggtgaacatgtcctgg
gaaaaaggtgagggaactgacctggacacacccatgcatctcaaggagaagacacagcta
cttcgggacactcctgagctgaccttggacacagagctcccgttggaggacaggagacat
gtgcaaggccatctggagcctcaggctctggggccaggcaggcaggaaggtctggagggc
aaccttgcccagggggctggactctcactgcccttgggagacctaatacagacccccata
atcagtggcccttcgaacatggacttggaggcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111144290
Entry
111144290         CDS       T05871                                 

Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111144290
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111144290
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111144290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111144290
   04090 CD molecules [BR:elk04090]
    111144290
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111144290
CD molecules [BR:elk04090]
 Proteins
  111144290
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 111144290
NCBI-ProteinID: XP_022354238
UniProt: A0A2Y9J023
LinkDB
Position
Unknown
AA seq 417 aa
MASALLILLWAMVILRADSLPDKKSLLLPPTNFTINVIGLAQVLLRWEPNPDQEPENVEL
GYHVRINAPQEEDYETRNTESKRITILHQGFSASVQTIPWDGHSLLASNWVSAELKAPLG
SPGTSIVNLTCTTTTTLNNSNPLRPYQVSLYCTWLVGKDAPKDTQYFLYYRYGSSTEECR
EYKKDTLKRNIACWFPRTFIRSRGSDLLAVHANGSSQCATIKPFDQLFALHAIDRINPPM
NVTAEIEGTYLSIQWEKPISPFPIHCFEYEVKIYNARKNYFQTEKMTTNTFISITDDISK
YSIQVRAAVSSVCRQTGLWSEWSQTVYVGNDDQKPFTEWFLIVLVATICFILLIFTLICK
IGHLWARLFPPVPAPKNSLKDFLVIVSPEKTVSSETEIEVISYVEESGLETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcatctgcattactgattctgttgtgggctatggtgatactgagagcagactcactt
cctgataaaaaatctttacttctcccacctaccaatttcaccatcaacgttatcggtcta
gcccaagttcttttgcgctgggaaccaaatcctgatcaagagccagagaatgtggagcta
ggctatcacgtgagaataaatgctccgcaagaagaagattatgaaaccagaaacactgaa
agcaaacgcataaccattcttcatcaaggcttttcagccagtgtgcagaccattccgtgg
gatggccactccctcctcgcaagcaactgggtttctgcggagcttaaagccccactgggg
tctcctggaacctcaattgtgaatttaacgtgtactacaacgaccacattaaataactct
aatccgttaaggccataccaagtttctctttactgtacctggctcgttggcaaggatgcc
cccaaggatacccaatatttcctctactataggtatggttcctcgaccgaagaatgccgg
gagtacaagaaagacacactgaagagaaacatcgcgtgctggtttccaaggacttttatc
agaagcagagggagtgacttgctggcggtgcatgctaatggctctagccaatgtgccaca
atcaagccttttgatcagctgtttgctctgcatgcaattgatcgaattaatcctcccatg
aatgtcacagcagagatcgaaggaacctatctttctattcagtgggagaaacccatttct
ccctttccaattcactgctttgaatatgaagtgaagatttacaacgcaaggaaaaattat
tttcagacagaaaaaatgacaacgaatacattcatctcgataactgatgatatttctaag
tattccattcaagtgagagcagcagtgagctctgtgtgcagacagacggggttatggagt
gagtggagccaaacagtatatgtcggaaatgatgatcagaagcccttcacagaatggttt
ctcatcgtgcttgtggcaaccatctgcttcatcctgttaattttcactctcatctgtaaa
ataggtcacttatgggccaggctgtttccaccggttccggcaccgaaaaatagtcttaaa
gatttccttgtaatcgtcagccctgagaaaactgtttccagtgaaacagaaattgaagtc
ataagttacgtggaagagtctggacttgagaccctggaagattctgtgttttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111145851
Entry
111145851         CDS       T05871                                 

Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X1
  KO
K05056  interleukin 11 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111145851
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111145851
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111145851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111145851
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111145851
SSDB
Motif
Pfam: Ig_3 ig Ig_2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 111145851
NCBI-ProteinID: XP_022356834
UniProt: A0A2Y9JAY9
LinkDB
Position
Unknown
AA seq 426 aa
MEGEMSSSCSGLSRVLLALAVALVSAASPCPEAWGPPGVQYGQAGRPMTLCCPGVTAGAP
VSWFRDGETRLLQGPDSGLGHELVLARADSTDEGTYICRTLDGALGGIVTLQLGYPPARP
VVSCQAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGVRMNPSTGPWPCPQDPPG
AARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRL
HASWTYPASWPRQPHFLLKFRLQYRPVQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSAR
DFLDAGTWSAWSPEAWGTPSTGPLLKEMPAEGQLQKPLEKEPQADSPTPPRPSLLPDPQP
LDHRDPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPDGKDGPQKPGFLAPVIPVDKI
PGAPNL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggagggggagatgagcagcagctgctcagggttgagcagggtcctgcttgccttggct
gtagccctggtgtctgccgcctccccctgtcccgaggcctggggccccccaggggtccag
tatgggcaggctggcaggcccatgacactgtgttgccctggagtgactgctggggccccg
gtgtcctggtttcgggacggggagacgagactgctccagggacctgactctgggctaggg
catgaactggtcttggcccgggcagacagcaccgacgaaggcacctacatctgccggacc
ctggatggtgcacttgggggaattgtgaccctacagctgggctaccccccagcccgccct
gttgtctcctgccaagcagctgactatgagaacttctcttgcacttggagtcccagtcag
gtcagcggtttacccacccgctacctcacctcctacaggaagaagaccgtaccaggagct
gatggcgtgaggatgaatccatccacagggccctggccatgcccacaggatcctccaggg
gctgcccgttgtgtagtccatggggcagagttctggagccagtaccgaataaatgtgact
gaggtgaacccgctgggggccagcacacgcctgctggatgtgagcttgcagagcatcttg
cgccctgacccaccccaggggcttcgggtagagtcagttcctggctacccccgccgcctg
catgccagctggacataccctgcctcttggccccgccagccccactttctgctcaagttc
cgactgcagtaccgtccagtgcagcatccggcctggtccacggtggagccagctggattg
gaggaggtgatcacggacgccgtggctgggctgccccacgctgtacgagtcagtgcccgg
gactttctggacgctggcacatggagtgcttggagtcctgaggcctggggaactccgagc
actgggcctttgctgaaggagatgccagctgagggacagctacagaagcccctggagaaa
gagcctcaggcagacagccccactccccccaggccctccctcctgccagacccacagcca
cttgaccacagagacccgctggagcaggtagcagtgttggcatctttgggaatcttctct
ttcctgggactggcagctggggccctggcactggggctctggctgagactgagaccagat
gggaaggatggaccccaaaagcctgggttcttggctccagtgattccagtagacaagatt
ccaggagccccaaacctgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111146386
Entry
111146386         CDS       T05871                                 

Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha isoform X1
  KO
K05059  ciliary neurotrophic factor receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111146386
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111146386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111146386
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111146386
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111146386
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Receptors
  111146386
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 111146386
NCBI-ProteinID: XP_022357623
UniProt: A0A2Y9JD71
LinkDB
Position
Unknown
AA seq 371 aa
MAAPVPWACCAVLAATAVVYAQRHSPQEVPHVQYERLGSDVTLPCGTANWDAAVTWRVNG
TDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLHHQVLLHVGLPPREPVLSCRSNTY
PKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSI
SVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLK
FFLRYRPLILDQWQHVELSDGTTHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATP
WTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLISVPVTLALA
AAAATANSLLI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgctcgctgccactgccgtcgtctac
gcccagagacacagtcctcaggaagtaccccacgtgcagtacgagcgcctaggttcagat
gtgactctgccatgtgggacagcaaactgggatgcagcagtgacatggagggtaaatggg
acagacctggcccccgacctgctcaacggctctcagcttgttcttcatggcttggaactg
ggccacagcggcctctatgcctgcttccaccgtgactcttggcacctgcaccaccaggtc
ctcctacatgtgggcttgccgccgcgggagcccgtgctcagttgccgttccaacacttac
cccaagggcttctactgcagctggcatctgcccacccctacctacatccccaacaccttc
aatgtgactgtgctgcacggctccaaaatcatggtctgtgagaaggacccagccctcaag
aaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcgata
agtgtcagcaatgccctgggccacaatgctacagctatcaccttcgacgagttcaccatt
gtgaagcctgaccctccagaaaatgtggtagcccgaccagtacccagcaaccctcgccgg
ctggaggtgacttggcagactccttcgacctggcctgaccctgagtcctttcctctcaag
ttctttctgcgctaccgacccctcatcctggaccagtggcaacatgtagagctgtcagat
ggcacaacgcacaccatcacagatgcctatgctgggaaggagtacatcatccaggtggcg
gccaaggacaatgagattgggacatggagtgactggagcgtggctgctcatgccacaccc
tggactgaggagccacgacacctcaccactgaggcccaggctccggagaccacgaccagc
accaccagctcactggcacccccacccaccacgaagatttgtgaccctggggagctgggc
agcggcggaggaccctcagcacccttcttgatcagtgtccctgtaactctggccctggct
gccgctgccgccactgccaacagtcttctgatctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147475
Entry
111147475         CDS       T05871                                 

Definition
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147475
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111147475
   04061 Viral protein interaction with cytokine and cytokine receptor
    111147475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111147475
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111147475
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Forkhead COX14
Other DBs
NCBI-GeneID: 111147475
NCBI-ProteinID: XP_022359214
UniProt: A0A2Y9JHT4
LinkDB
Position
Unknown
AA seq 301 aa
MRNILQWSPPEGLQGTEVTYTVQYFIYGQKKWLNKSECRNISRTCCDLSVETSDYEHQYY
AKVKAIRETNCSKWAETGRFYPFLETQIGPPGIVLMTDERSISIVLTALEKWKRNPEDRS
LSMKQIYSNLKYNVSIYNTQSNRTWSQCVTNQTLVLGWLEPDTLYCVHVESFVPGPPRLA
RPSEKLCVCTLKDQTSAVKVKIIFWYVLPISVTVFLFSVMGYSMYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVLYFIILNIVEDSNISHQDVSVRGKSNDVWDLNEPLIHLSMA
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaggaatatcctacagtggagcccaccagagggcctacaaggaactgaagttacttac
actgtgcagtatttcatatatgggcaaaagaagtggctgaataaatccgaatgcagaaat
atcagtaggacctgctgtgatctctctgtggaaacttctgattacgaacatcaatattat
gccaaagttaaggccattcgggaaacgaattgttccaaatgggcagaaactggacgattc
tatccattcttagaaacacaaattggcccaccgggaatcgttttgatgacagatgagaga
tccatttccattgttctgacggctctggagaagtggaagagaaatccagaagaccgttct
ctttccatgaaacagatatactctaatctgaagtataatgtgtccatatataatactcaa
tctaatagaacgtggtcccagtgtgtgaccaaccagacgctggtgctgggctggctggag
ccagacactctgtactgcgtccatgtggagtccttcgtcccagggcctcctcgcctagct
cggccttctgagaagctgtgtgtctgtactttgaaagaccaaacatcagcagtgaaggtt
aaaatcatcttctggtatgttttgcccatatctgttactgtgtttcttttttctgtgatg
ggctactccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtacctgctgaaaaaattgtgctt
tattttatcatcctcaatattgtggaagattctaacatttctcatcaggatgtaagtgta
aggggaaaaagcaacgatgtatgggacctgaatgagcccctcattcatttaagtatggct
atttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147686
Entry
111147686         CDS       T05871                                 

Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04066  HIF-1 signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05200  Pathways in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147686
   04066 HIF-1 signaling pathway
    111147686
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111147686
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111147686
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111147686
   04658 Th1 and Th2 cell differentiation
    111147686
   04659 Th17 cell differentiation
    111147686
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111147686
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147686
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111147686
  09163 Immune disease
   05321 Inflammatory bowel disease
    111147686
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111147686
  09172 Infectious disease: viral
   05164 Influenza A
    111147686
   05168 Herpes simplex virus 1 infection
    111147686
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147686
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111147686
   05140 Leishmaniasis
    111147686
   05142 Chagas disease
    111147686
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111147686
   04090 CD molecules [BR:elk04090]
    111147686
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IFN receptor family
   111147686
CD molecules [BR:elk04090]
 Proteins
  111147686
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind DUF1179 DUF778 Pox_EPC_I2-L1 bCoV_NS7B
Other DBs
NCBI-GeneID: 111147686
NCBI-ProteinID: XP_022359618
UniProt: A0A2Y9JF35
LinkDB
Position
Unknown
AA seq 474 aa
MALQLLLLLVLQAESWGEMSPADLELPSVPVPTNINIKAYNFNTVLYWDYPTMPQTPVFT
VQVKTYGEAIWIDACNTSQHFCNIFSVINDPSLSLWARIKARLGQKESAYVESKEFILCK
QGNIGPPAVGIRKRENQIIIDIFHPLVNTSEREPVPIYDENHCHMFTYTVYLRINGSKIP
YLMSVENEDDCNETQCHLVIPVSSLSSDYCISAEGFSKDWSVKTEMSDELCITTSDDNHI
EDSFWVPVVAILLFLVLILVFVYCYTKKMNPCKKESIMLPKSLLSVVKNASSEARSEPKC
VSPITYQPIVPENEKMVWEDQLSPATILSMPTEDSLGKTEHREDVSSEIEVVTAEENNPD
TAPGSPLTPRMGESSVHSNSNQSEPCVVALNSYHSRNGSDSGVVESDSFLSDSEFPPNNK
TEIKTEGPESVVLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRPTADSKEFS
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggctctgcaacttctgctcctcctcgtcttgcaggccgagagctggggtgagatgagc
cccgcggatctggaactgccttcggtgccagtaccaaccaatattaacattaaggcctat
aattttaatactgtcctatattgggactacccaaccatgccacagacccctgtttttact
gtacaggtaaagacctatggggaagcaatatggattgatgcctgcaatacctctcagcac
ttttgtaatatcttttccgtaattaatgatccatcactttctctctgggccagaattaaa
gctaggcttggacaaaaagaatcagcctatgtagagtcaaaagaatttattctgtgtaaa
caagggaacattggaccacctgcagtgggtatcagaaagagggaaaaccaaatcatcatt
gacatatttcaccctttagttaatacaagtgaaagagagccagtacccatatatgatgaa
aatcattgtcacatgtttacgtacactgtgtatttaagaataaatgggagtaagattccg
tatctgatgtcagtagagaatgaagatgattgcaatgagactcagtgccacctcgttatc
ccagtgtcctctctgagttcggactactgtatttcagcagaagggttctcaaaagattgg
tctgttaaaactgagatgtctgatgaactttgtattaccacttctgatgataaccacata
gaagattctttttgggttccagttgttgccattctgctttttctagtacttattctggta
tttgtatattgttacactaagaagatgaatccatgtaagaaggaaagcatcatgttaccc
aagtccttgctgtctgtggtaaaaaatgcctcttcagaggcaaggtctgaaccaaaatgt
gtatcacccatcacctaccagccaattgtcccagaaaatgagaagatggtctgggaagac
cagttgtctccagccacaattttaagtatgcccactgaagacagcctaggaaaaacagaa
caccgagaagatgtttccagtgaaatcgaagtggtcactgctgaagaaaataatcctgac
acagctcctggtagccctctgaccccaagaatgggagagagttctgtccattcaaatagt
aaccagtctgaaccctgtgtcgtcgccttaaactcctatcactccagaaatggttccgat
agtggcgttgtggaatctgacagcttcttatctgactcagaatttcccccaaataataaa
actgaaataaagactgaaggaccggagtctgtagtgctgagaaacactaccacctccttt
ggttacgataagccgcatgtgttagtggatctgcttgtggatgaaggtggtaaggagtcc
ttgattggttatagaccgacggcagattccaaagagttttcctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147765
Entry
111147765         CDS       T05871                                 

Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111147765
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111147765
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111147765
NCBI-ProteinID: XP_022359701
UniProt: A0A2Y9JGH4
LinkDB
Position
Unknown
AA seq 231 aa
MPPKHCFLGFLICFFPTGVVETQSAHESLKPQRVHFQSRNFHNVLHWQPGRACTSNSSIY
FVQYKTYGQRQWKNKEDCWGILEFFCDLTNETSDIQEPYYGRVRTTSAGIHSDWTMTRRF
TPWWETRIDPPVMNITQVNGSLLVILHAPNLPYRDQKGKNVSIEDYYELVYRVFIINNSL
EKEQKVYEGAGRVVEIGALAPGSAYCVVAEIYQPMLGRRSQRSEERCVELP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccgcccaagcattgctttctaggcttcctcatctgtttcttcccgactggggttgta
gaaactcagtcagcccatgagtctctgaagcctcagagagtacatttccagtctcgaaat
ttccacaacgttttgcactggcagcctgggagggcttgcaccagcaacagcagtatctac
tttgtgcagtataaaacgtacggacagagacaatggaaaaataaagaggactgttggggt
attctagaattcttttgcgaccttaccaatgaaacatcagatatacaggaaccttactat
gggcgagtgaggaccacctctgctgggatccactcggactggaccatgacacggcgcttc
actccctggtgggaaacaagaatagatcctccagtcatgaatataacccaagttaatgga
tctttgttggtgattctccatgctccaaatttaccatatagagaccaaaaaggaaaaaat
gtatcaatagaagattattatgagctagtataccgagtctttataattaataattcactg
gaaaaggagcaaaaggtatatgaaggagctggcagagttgttgaaattggagctctggca
cctggctctgcttactgtgtggtggctgaaatttatcaacccatgctaggccgaagaagt
cagagaagtgaagaaagatgtgtggaacttccttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111148924
Entry
111148924         CDS       T05871                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148924
   04014 Ras signaling pathway
    111148924
   04015 Rap1 signaling pathway
    111148924
   04630 JAK-STAT signaling pathway
    111148924
   04020 Calcium signaling pathway
    111148924
   04072 Phospholipase D signaling pathway
    111148924
   04151 PI3K-Akt signaling pathway
    111148924
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111148924
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111148924
   04540 Gap junction
    111148924
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111148924
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148924
   05206 MicroRNAs in cancer
    111148924
   05230 Central carbon metabolism in cancer
    111148924
   05231 Choline metabolism in cancer
    111148924
  09162 Cancer: specific types
   05214 Glioma
    111148924
   05218 Melanoma
    111148924
   05215 Prostate cancer
    111148924
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111148924
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111148924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111148924
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:elk04090]
    111148924
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111148924
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111148924
CD molecules [BR:elk04090]
 Proteins
  111148924
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 111148924
NCBI-ProteinID: XP_022361426
UniProt: A0A2Y9JLH6
LinkDB
Position
Unknown
AA seq 1090 aa
MMGTSLPALLILGCLLPGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQY
PMSEEENPNVEIRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTEEMELEGRHIYI
YVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLISSEGVVHASYDSRQGFN
GTFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFN
NEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEV
KEMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIEN
LTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILD
LVDDHHGTTGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWAILASNISNIITEVHPR
DRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVI
VSLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRS
YVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSVLDSEVK
NLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYK
KSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSVDEQRLSADSGYI
IPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgatggggacctcccttccggccctgctgatcttaggctgtcttctcccagggcccagc
ctaatcctctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtg
cagctgaattcgtccttttctctgagatgctttggggagagtgaagtgagctggcagtac
cccatgtctgaagaagagaaccccaatgtggaaatcagaaatgaggagaacaacagcggc
ctctttgtgactgtgctggaagtggtcaatgcatccgcggcgcacacaggcttgtacact
tgctattacaaccacacacagacggaggaaatggagctcgaaggcagacacatctacatc
tatgtgccagacccagatgtagcctttgtacctttgggaatgaccgattatttagtcatc
gtggaggatgatgattctgccatcataccttgtcgcacgactgatcccgagactccggtc
accttgataagcagtgaaggggtggtgcacgcctcctatgacagcagacagggcttcaat
gggaccttcagcgtcgggccctatatctgcgaagccaccgtcagggggaagaagttccag
accattccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaa
gctcttaaaactgtgtataagtcaggggagacgattgtggtcacctgtgctgtctttaac
aacgaggtggtcgaccttcagtggacgtaccccggagaagtgaaaggcaaaggcatcacc
atgctggaggaaatcaaggtcccgtccatcaaattggtgtacactctgagggtccccgag
gccacggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtc
aaagagatgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaaccc
aacttcagcccactggaagctgttgacctacatgaagtcaaacatttcgtggtggacgtg
caggcctacccccctcccaggatatcctggctgaaggacaatctgactctgattgaaaat
ctcacagagatcaccacggacatagaaaagattcaggaaataagatatcggagcaaatta
aagctgatccgcgctaaggaggaagacagtggccattacacaattgttgttcaaaacgag
gatgacgtgaagagctatactttcgaactcttaactcaagttccctcctccattctggac
ttggtcgacgaccaccatggcactacggggggacagaccgtgagatgcactgctgaaggg
acgccacttcctgacatcgagtggatggtctgcaaggatattaagaagtgtaataatgaa
acttcatgggcgattttggccagcaatatctcaaacatcatcacggaggtccacccccga
gacaggagtactgtggagggacgagtgacattcaccagagtggaggaaaccatcgctgtc
cgatgtctggccaagaacctccttggggctgagagccgagagctgaagctggtggcgccc
acactgcgatccgagctcactgtggccgctgcggtcctcgtgctgctggtgattgtgatc
gtctcactcattgtcctggttgtcatttggaaacagaaacccaggtatgaaatccgttgg
agggtcattgaatccatcagccctgacggacatgaatatatttatgtggacccaatgcag
ctgccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctg
ggatctggtgcgtttgggaaagtggttgaaggaaccgcctatgggttaagccgctcccag
cctgtcatgaaagtagccgtgaagatgctgaaacccacagccagatccagtgagaagcaa
gctctcatgtcggaactgaagataatgactcacctggggccacatttaaacattgtgaac
ttgctgggagcctgtaccaagtcaggccctatttacatcatcaccgaatactgcttctat
ggggatttggtcaactatttgcataagaacagggatagcttcctgagccgccacccggag
aagccgaagaaggagttggacattttcggattgaaccctgcggatgacagcacacggagt
tacgttattttatcttttgaaaacaacggggactacatggacatgaagcaggctgacacc
acacagtacgtccccatgctggagaggaaggaggtttctaagtactcagacatccagaga
tcactgtatgatcgcccagcctcatacaagaagaaatctgtgttagactcagaagtcaaa
aatctcctttcggacgacaactcagaaggccttactttgttggatttgttgagctttacc
tatcaagttgcgcgaggaatggaatttttggcttcaaaaaattgtgtccaccgggacctg
gctgctcgaaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggtctg
gccagagacatcatgcatgattccaactacgtgtctaaaggcagcaccttcctccccgtg
aagtggatggcccccgagagcatcttcgacaatctctacaccacgctgagtgacgtctgg
tcttacggcattctgctctgggagatcttttcccttggcggcacaccgtaccccggcatg
atggtggattcgactttctacaataagataaagagcgggtaccggatggccaagccggac
cacgccaccagtgaagtctacgagatcatggtgaagtgctggcacagtgagccagagaag
agaccctccttctaccacctgagtgagattgtggagaatctgctgcctggacagtacaag
aagagttacgagaagattcacctggactttctgaagagcgaccaccccgccgtggcgcgc
atgcgcgtggacgcagacaacgcctacatcggcgtcacctacaaaaacgaggaggacaag
ctgaaggactgggagggcagcgtggatgagcagaggctgagtgcggacagcggctacatc
atccccctgcccgacattgaccccgtccctgaggaggaagacctgggcaagaggaacaga
cacagctcgcagacctctgaagagagcgctatcgagacaggttccagcagctctaccttc
atcaagagagaggacgaaaccatcgaggacatcgacatgatggacgacattggcatagac
tcctcagacctggtagaggacagcttcctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153726
Entry
111153726         CDS       T05871                                 

Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111153726
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111153726
   04061 Viral protein interaction with cytokine and cytokine receptor
    111153726
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111153726
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111153726
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111153726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111153726
   04090 CD molecules [BR:elk04090]
    111153726
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111153726
CD molecules [BR:elk04090]
 Proteins
  111153726
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111153726
NCBI-ProteinID: XP_022368616
UniProt: A0A2Y9K5I9
LinkDB
Position
Unknown
AA seq 574 aa
MLPHLVVLLAVLLSLCLGSCAHGTELPRPPSVWFEAEFFSHVLHWTPIPKPSNSTYYEVE
LLRYGQELWNSIPSCSQTQVSFCDLTMVTLDLYHNNGYRAKVRTVDGNQYSNWTCTNTRF
SVDEVTLTVGSVKLEVHNGVILGKIQPPRPRTAPADDTYESIFPHFREYEIQIRKVPGNY
TFTKVKVKHENFSLSPPGELGEFCVKVKPSLSSRLNKGLWSKEECIVLTRQYFTATNLSI
FFTFVPLLCGTLAYCLALHLYVRRRRKLPTVLVFEKPQPSSFISQLPYPEPQDAVNPLDE
EAFPKVSPELKNSELHGSTDSGFGSGKPSLQNEEPQFLLPSSHPQAGGTVGKGAPPELEN
SSGGSSSSTDSGICLQEPSLSPGTGPSWERQVGDSSEGQDDSGIGLVQNSEGQPGDGQGG
SNNPLGPEGPGEEDPASVAFRGYLKQTRCTEEKAAKTGCLEEESSATDSLGPRLRTCLDA
EAGWPPPVLAKGYLKQDPGMTVTPSGTSTGQWDHPTEQWSLLGMTSCADLGASDWTLAHD
LAHLDSVAAPVGLLGSFDSNLVTLPLISSLHSSE
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgctgccgcacctggtagtgctactggcggtgcttctcagcctgtgcctcggctcctgc
gcgcacgggacagaactgcctaggccgccatctgtgtggtttgaagcagaatttttctcc
catgtcctccactggactcccatcccgaaaccatcaaacagcacctactatgaagtagaa
cttctgaggtacgggcaagaactctggaattccatccccagctgcagccagacccaagtg
tcattctgtgacctcactatggtgaccctggacctgtaccacaacaatggctaccgagcc
aaagtccgcacagtggatggaaaccagtactccaactggacctgcaccaacacccgcttc
tctgtggatgaagtgactctgacggttggcagtgtgaagctagaggtgcacaacggtgtc
atcctcgggaagatccagccccccaggcccaggacagcccctgcagacgacacctatgaa
agcatcttcccacacttccgcgaatatgagattcagatccgcaaggtgccggggaactac
acgttcacaaaggtgaaggtgaaacatgaaaacttcagcctctcacctcctggagaactg
ggagagttctgtgtcaaggtgaagccatctctgagctcccgactgaacaaggggctatgg
tccaaggaggagtgcatcgtgctcacccggcagtatttcaccgcgaccaacctcagcatc
ttcttcaccttcgtcccgctgctgtgcggaaccctggcctactgcctggccctccatctg
tacgtgaggcgccggaggaagctgcccaccgtcctggtctttgagaagccccagccctcc
agcttcatcagccagcttccctaccctgagcctcaggacgccgtcaatcccctggacgag
gaggccttccccaaagtgtccccagagctgaagaactcggaactgcatggcagcacggac
agtggctttggcagtggcaagccatccctgcagaatgaagaaccccagttcctcctccct
tcctcccacccccaagctggagggaccgtaggcaagggggcgcccccagagctggagaac
agcagtggcggcagcagcagcagcacggacagcgggatctgcttgcaggagcccagcctg
agtcctggcactggccccagctgggagcggcaggtgggggacagcagcgagggccaagat
gacagtggcattggcctcgtccagaactctgaggggcagcctggagatgggcagggtggc
tccaacaatccccttgggcctgaggggcctggagaagaagacccagcctcagtggctttc
cggggctatctaaagcagaccagatgcacagaggagaaagcagccaagacaggctgcctg
gaggaagagtcctccgcaacagacagccttggccccaggctcaggacatgcctggatgcc
gaggcaggctggcctccaccagtgctggccaagggctatttgaaacaggacccaggaatg
actgtcactccctcagggacctcaactggacagtgggaccacccaactgagcagtggtca
ctcctgggcatgaccagctgtgctgacctaggagcatctgactggaccttggcccatgat
cttgcccatctggatagtgtggcagccccagtcggtctcctgggcagctttgactcaaac
ctggtcaccctgccactgatctccagcctccactccagtgagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154911
Entry
111154911         CDS       T05871                                 

Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111154911
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111154911
   04061 Viral protein interaction with cytokine and cytokine receptor
    111154911
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111154911
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111154911
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111154911
NCBI-ProteinID: XP_022370575
UniProt: A0A2Y9KMR7
LinkDB
Position
Unknown
AA seq 580 aa
MRTLLTILAAGSLAAHTAENTSDLLQHVKFQSSNFENILTWDSGLESAPDLVYSVEYKTY
GERKWLVKEGCQRITRKSCNLTMETGNFMEPYYARVTAISAGGRSVTKMTDRFTSLQQTT
IKPPDVTCIPKVRSIQMVIHPTSTPVQAGDGHRLTLEDIFPDLFYRLELQVNHTYQMHLG
GKQRDYEFTGLTPDTEFLGTTMIFVPNWSKESAPYVCRVKTLPDRTWTYSFSGAILFSMG
FVVAGLCYLSYRYVSKPPPPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSSPSSLAQPVQ
YSQVKVSGPREPPGSPPRHSVSEITYLGQPDVSVLRASGVPPQQTLTSLSYAPQAAPEVK
PLSYAPQVTPEAKTPCYTAQAMAEVQPPSYTPQTAPDRWPSYGTCGEGSGRDSPPVTPSS
PQHRRTKGQLQKKAPAETHIPGGLPLQGVTSLDMKDPQEANFFHQPLGAHKDRAPDPRVL
HRGEPGTPSYLKGQLPLLASVQIEGHPVSLPLHTPSLPCSPTDQEPSPWRLLESLVCPKD
EGPESGMEAQSPASQDLDLEPPTELDSLFRGLALTVQWEA
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaggacgctactgaccatcctggccgcgggatccctggccgctcacactgctgagaac
acctcagatcttcttcagcacgtaaaattccagtccagcaacttcgaaaacatcctgacg
tgggacagcgggctggagagcgccccagacttggtctacagcgtggagtataaaacgtat
ggggagagaaagtggctggtgaaggagggctgccagcggatcacccggaaatcctgcaac
ctgaccatggaaacgggcaacttcatggagccctactacgcccgggtaactgccatcagc
gcgggaggccggtcagtcaccaagatgaccgaccggttcacctcgctgcaacagactacc
atcaagccacccgatgtgacctgtatccccaaggtgagatccatccagatggtcatccat
cccacctccacacctgtccaagcaggggatggccaccggctcaccctggaggacatcttc
cctgatctgttctaccgtttagagctccaagtcaaccacacctaccaaatgcaccttgga
gggaagcagagagactacgagttcactggcctgacccctgacacagagttccttgggacc
accatgatttttgttccaaactggtccaaagagagcgccccctacgtgtgccgagtgaag
acactgccagatcggacgtggacatactccttctcgggcgccatcctcttctccatgggc
ttcgtcgtcgcggggctctgttacctgagctacagatacgtctccaagccgcctccgcct
cccaactccctgaacgtccagcgagtactaaccttccagcctctgcggttcatccaggaa
cacgtgctgatccccgtctttgacctgagcagccccagcagtctggcccagcccgtccag
tactcccaagtcaaggtctctgggcccagggagcccccaggatccccaccacggcacagt
gtgtctgagatcacctatcttgggcagccagacgtctccgttctccgggcctctggagtg
ccacctcagcagacgctcacctcactgtcctacgcaccccaggcggcccctgaagtcaag
cccctgtcctatgcgccccaagtaacccccgaagctaaaactccatgctacactgcacag
gccatggctgaggttcagcctccctcctacacccctcagaccgctccagaccgctggcct
tcctatgggacctgcggggaaggctctggcagagactccccacccgtgacaccctctagt
ccccaacaccgcaggactaaaggtcagctccagaaaaaggcaccagctgaaacccatatc
ccaggtggccttcctctgcaaggggtgacctccttggatatgaaggacccccaagaagca
aatttcttccaccagcctctgggagctcacaaggacagagcacctgaccccagggtacta
catagaggggaacctgggacaccatcatacctaaagggccagctcccccttctcgcctct
gtccagatcgagggccacccggtctccctccctttgcacactccttccctcccatgttcc
cccacagaccaggaaccaagtccctggagactgctggagtccctcgtgtgtcccaaggat
gagggtcctgagtctgggatggaggcccagagcccagcctctcaggacttagacctggag
ccccccacagaactggactctctctttagaggcctggccctgaccgtgcagtgggaggcc
tga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154913
Entry
111154913         CDS       T05871                                 

Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111154913
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111154913
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111154913
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111154913
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Chromate_transp
Other DBs
NCBI-GeneID: 111154913
NCBI-ProteinID: XP_022370577
UniProt: A0A2Y9KA27
LinkDB
Position
Unknown
AA seq 515 aa
MTSFSPTGKPLLPPPQNVTLLSRDFGVYLTWLPGPGYSQNVTYFVAYQSAATPRRWRKVQ
KCKGTKELVCSLMCLEKQDLYNKFKGRVWAASASARSPMVESKYLDYLFEVEPAPPALVV
TRTEEVLSINATYELPHCMPRPDLKYEVDFWKEGIKNKTRFPVTSHGQPVQIPLQPAASG
HYCLSARTIYTFGDPKYSEFSKPTCFFVDAPGASWAFLVLLPLLLPLLLVIAIGFVIWKN
FRENPWFQQAKMPWALDFSGNRYPTATLHPSGPEPLDTLTLCPQKELTRRVRPSPRVRTP
ATIQAGPEKNSAEEEDDEEDADNNVNFQTYLEPPSFLGQEHQIPGNSAAGDTWSPPVQVE
GWSATDASDRSWASAGGSSPWDESESSCYLAKKTLGQGPGGDECQEPLPLPEFSKDLSFL
EDPWKDDLSSWVSWGSFSPGLDLLPGEPPVSLHTLTFCWDSNPEEEEEEEEDEEESEDGG
GRESEIEDDSPGSWGAGNLQKAEVRGRTLGHYMAR
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgacttctttctctcccacagggaagccccttctcccccctccccagaacgtgacgctg
ctctcccgggacttcggtgtgtacctgacatggctcccagggcctggctactcccagaac
gtgacctattttgtggcctatcaaagtgctgcgacccccagacggtggagaaaagtgcag
aagtgcaaaggaaccaaagagctggtgtgttctttgatgtgcctggagaaacaggacctg
tacaacaagttcaaggggcgcgtatgggcggcttctgccagcgccaggtcccccatggtg
gagtccaagtacctggactacctttttgaagtggagccagccccacccgccctggtagtc
actcggacagaggaggtcctgagcatcaatgccacctacgagctgccccactgcatgccc
cgaccggatctgaagtatgaggtggatttctggaaggagggaatcaagaacaagacgcga
tttccagtcacctcccacggccagccagtgcagatccccctgcagccggccgccagtggc
cactactgcctcagcgccaggaccatctacacctttggtgatcctaaatacagcgagttc
tccaagcccacctgcttcttcgtggatgcccccggagccagctgggcattcctggtgctg
ctaccacttctgcttcccctgctgttggtcattgccataggctttgtgatctggaagaac
ttcagagagaacccctggtttcagcaggcaaagatgccatgggccctggacttttctgga
aacagataccccacggcaacccttcatcccagtggtcctgagcccctggataccttgacc
ctctgtccccaaaaggaactgaccagaagggtccggccaagccccagagtcaggacccca
gccaccatccaggcaggaccagagaagaacagtgctgaggaggaggacgatgaggaggac
gcagacaacaatgtcaactttcagacctaccttgaaccaccctccttcctagggcaggag
caccagatcccgggaaactctgcggcaggggacacctggagccctcctgtccaggtcgaa
ggctggtctgctaccgatgcttcagacagaagctgggccagtgcggggggctcctccccc
tgggatgagtctgagtcctcttgctatttggccaagaagacactaggccaagggccaggt
ggggacgagtgtcaggagcctctcccactgcctgaattctccaaggacttgagtttcctg
gaagatccctggaaagatgacctctcctcctgggtcagctggggctctttctcaccaggg
ctggatctgctccctggggagcccccagtttctctccacacactgaccttttgctgggac
agcaaccctgaagaggaagaggaggaggaggaggacgaagaagaaagtgaagatggagga
ggaagggaatcagaaattgaggatgacagtcctggcagctggggggccgggaacctacag
aaggctgaggtcagaggtcggaccctgggacattacatggccaggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155008
Entry
111155008         CDS       T05871                                 

Definition
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155008
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111155008
   04061 Viral protein interaction with cytokine and cytokine receptor
    111155008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111155008
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111155008
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 111155008
NCBI-ProteinID: XP_022370708
UniProt: A0A2Y9KC46
LinkDB
Position
Unknown
AA seq 294 aa
MWFLYALIPCLLVDGVAVLPAPQNLSVHSTNMKHLLMWSPVVVPGEIIHYFVEYQGEYES
LYMSHIWIPSSWGSPTEDPECDITDDITATVPYNLRVRASLGSQTSAWSTLQHPFNRNST
ILTPPVMEVTKDGFHLVIKLEDLGPQFEFLVAYWRREPGAKEHVKVVRSRGIPVHLETME
PGVAYCVKVRTLVKAIGRHSPFSQVECVKVQGETLPLALALFAFVGFMLILVVVPLSIWK
MGRLLRYSCCPVVVLPSTLKITNSPQKLISCRREEVEPCATAVLSSEEPFRAWL
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtggtttctctacgccttgattccttgtttactcgtagatggagtggccgtcctgcct
gcccctcagaacctctctgtacactcaaccaacatgaagcatctcttgatgtggagccca
gtggttgtgcctggagaaataatacactattttgtcgagtaccagggagagtatgagagc
ctgtacatgagtcacatctggatccccagcagctggggctcacccactgaagatcctgaa
tgtgacatcactgatgacatcactgctactgtgccatacaacctccgtgtcagggccagc
ctcggctcacagacctcagcctggagcaccctgcagcatccttttaaccgaaactcaacc
atcctcacaccacctgtgatggaggtcaccaaggacggcttccacctggttattaagctg
gaagacctggggccccagtttgagttccttgtggcttactggaggagggagcccggtgcc
aaggaacatgtcaaagtggtgaggagcaggggcattccagtgcacctggaaaccatggaa
ccaggagtcgcatactgtgtgaaggtccgcacgttggtgaaggccatcgggaggcacagc
cctttcagccaggtggagtgtgtcaaggtacaaggagagaccctccccctggcgctggcc
ctgtttgcatttgttggcttcatgctcatccttgtggtggtgcccctttccatctggaaa
atgggccggctgctccggtactcctgttgccccgtggtggtactccccagcaccttgaaa
ataaccaattcaccccagaagttaatcagctgcagaagggaagaggtggaaccttgtgcc
acagctgtgctgtcttctgaggaacccttcagggcctggctttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155645
Entry
111155645         CDS       T05871                                 

Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05160  Hepatitis C
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155645
   04151 PI3K-Akt signaling pathway
    111155645
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111155645
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111155645
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111155645
   04621 NOD-like receptor signaling pathway
    111155645
   04650 Natural killer cell mediated cytotoxicity
    111155645
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111155645
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155645
  09172 Infectious disease: viral
   05160 Hepatitis C
    111155645
   05171 Coronavirus disease - COVID-19
    111155645
   05164 Influenza A
    111155645
   05162 Measles
    111155645
   05168 Herpes simplex virus 1 infection
    111155645
   05167 Kaposi sarcoma-associated herpesvirus infection
    111155645
   05169 Epstein-Barr virus infection
    111155645
   05165 Human papillomavirus infection
    111155645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111155645
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IFN receptor family
   111155645
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 111155645
NCBI-ProteinID: XP_022371627
UniProt: A0A2Y9KEN1
LinkDB
Position
Unknown
AA seq 504 aa
MLWSQNASPLRSQNLCFVVCISLLSGVLSSLPELSDKSCTFKVTLRNFRVILSWEVKNHS
IVPDHYTLQYTVISRPDGVKTVEHCSNITASFCDLTDVWEVLPETYAVTVDGFRGNTTLV
TCFVDFFLAAYISLEPPEFDIVNFIDHINVNVNFPPVLPKILEELLQFHLSLIIEEQSGE
IVKKHNPVLDENVIGNFTYVIDKLLPNTNYCVSIYFMPRNLEAIRRSPVKCTLLQPARDT
GSSESARIGGIITMFLIAAVFISTIIILKRVGYICLRNDFPKVLNFNNLSAWVFPEMPPL
EAVAFVEVIHINRKKKVWNYNYNDESDSNDEATAPLTSTGGYTKHGLLSGLPGPTSASSA
TGQDCLEPDTEEPNLSELEAESLMAPEPSPRLGKLLQDRFSEDGSSTEEAGDKIIFNVNL
SSVFVSTLDDDSDIPPVLPSFPEETYDLEDSHTLEPSFLASGGEGTQPPFPTPSAECPCP
EDVLSDKNDNSESDVDIGDGYIMR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgctttggagccagaatgcttccccgcttagatcacagaatctgtgtttcgtggtgtgt
atcagcctcctgtctggtgtgttatcttcactgcctgaattgtcagacaaatcttgcact
ttcaaggtgacattacgcaatttccgggtcatcttatcttgggaagtgaaaaaccattcg
atcgtaccagatcactatacattacagtacacggttataagtagaccagacggtgtgaag
actgtggagcactgttcaaatatcacagcatcattctgtgacctaacggatgtgtgggag
gtcctgcccgagacgtacgccgtcacagttgacgggttcagagggaacacaacgctggtc
acgtgtttcgtcgatttcttcctggcagcatacatatctttggaaccaccagagtttgat
attgttaactttatcgaccacattaacgtcaatgtgaattttccacccgtccttcccaag
atactagaagaactattacagtttcacctgtcacttatcatcgaagaacagtcaggggag
attgtcaagaagcataaccccgtactagatgaaaacgtcattggaaatttcacttacgtc
atcgacaagttacttccaaacacaaactactgtgtatctatttattttatgcctagaaat
ctggaagcaatacgcagatcaccagtaaaatgtaccctccttcaacctgcacgggacaca
gggtcatcagaatctgccagaataggaggaataattactatgtttttaatagctgctgtc
ttcataagcaccataataatactgaaacgggtcggttatatatgcttaagaaatgatttc
cccaaagttttgaattttaataacttgtcagcctgggtattccctgagatgccaccattg
gaagcagtggcttttgtggaggtgattcatattaacaggaagaagaaggtgtggaattac
aattacaacgacgaaagtgacagcaacgatgaagccaccgcccctctgacaagcacaggg
ggctataccaagcacgggctgctgagtgggcttccgggtcccacctctgcctcctcagcc
accgggcaggactgcctggagccggacacggaggaacctaatctgtccgagctggaggcg
gagtcactgatggcaccagagcccagccccaggctagggaagctgctacaggaccgcttt
tccgaggacggcagctccacagaagaggctggggacaaaattatcttcaatgtaaatctg
agctctgtattcgtgagcaccctcgatgacgattcggacatccctccggtgttaccaagt
tttccagaagagacatatgacctagaggattcccacacactggaaccaagctttctggcc
tccggcggggaagggacacagccaccctttcccactccctctgcagagtgcccttgtcct
gaagatgtgctttctgacaaaaatgacaattctgagtcggatgttgacatcggggatggc
tatataatgaggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155682
Entry
111155682         CDS       T05871                                 

Definition
(RefSeq) interferon gamma receptor 2 isoform X1
  KO
K05133  interferon gamma receptor 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04066  HIF-1 signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
elk05200  Pathways in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155682
   04066 HIF-1 signaling pathway
    111155682
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111155682
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111155682
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111155682
   04658 Th1 and Th2 cell differentiation
    111155682
   04659 Th17 cell differentiation
    111155682
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111155682
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155682
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111155682
  09163 Immune disease
   05321 Inflammatory bowel disease
    111155682
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111155682
  09172 Infectious disease: viral
   05164 Influenza A
    111155682
   05168 Herpes simplex virus 1 infection
    111155682
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111155682
   05140 Leishmaniasis
    111155682
   05142 Chagas disease
    111155682
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111155682
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IFN receptor family
   111155682
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 111155682
NCBI-ProteinID: XP_022371681
UniProt: A0A2Y9KDV8
LinkDB
Position
Unknown
AA seq 347 aa
MRPPPPPLSLLSLLLLLGGHGTAAPPADSLSQLPAPRNPKVHLYNAEQVLTWEPGSLSND
SRPVVYQVQYKYFSGSRWYDANDLGVNCMNLTKPECNFTPSSLSKGFPPHFNISLRVRAK
LEDLASPWLTVPWFLSCWNVTVGPPENIWVTPGEASLIIRFSSPFDIPPDRGYFQYYVHY
WEKAGIQKVKGPFKSNSIVLDGLRPLREYCLQVKAHLFRTSCNTSRPGRLSNITCYETMM
DATTKLQQVILIAVGVFLLLAVLAGGCFFLVLRYKGLVKYWFHSPPSIPSQIEEYLKDPS
QPILEALDTDTSPTDDAWDSVSIVSFPEKEQEDVPQSTLTQNSAAVC
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcggcccccgccgccgccgctgtcgctcctgtcgctgctgctgctgctcggcggccac
ggcaccgccgcgcccccggcagactctctctcccagctgccagctcctcgaaacccgaag
gttcacctgtacaacgccgagcaggttttgacttgggagccggggtccctgagcaatgac
agcaggccagtggtctaccaggtgcagtacaaatacttctctggcagtaggtggtacgat
gccaacgacttaggtgtgaactgtatgaacctcaccaagccggagtgtaacttcacccca
agcagcctctcaaagggtttcccaccacatttcaacatctctttacgcgtccgagctaag
ctggaggacctggcttccccctggctgacagtgccttggttcctgtcctgttggaatgtt
accgttgggcctcctgagaacatctgggtgacaccgggagaagcctccctgatcatcagg
ttctcctctcccttcgacatccctcccgaccggggctatttccagtactatgtccattac
tgggaaaaggcaggaatccaaaaggttaaaggtcctttcaagagcaactccatcgtgttg
gatgggttgagacccttaagagaatactgtttacaagtgaaggcgcatctctttcgcaca
tcctgcaacacctctagacccggccgcttaagcaacataacttgctacgaaacaatgatg
gatgccactaccaagcttcaacaagtcatcctcatcgccgtgggagtctttctgttgctg
gcggtgctggcggggggctgtttcttcctggtgctgagatacaaaggcctggtaaaatac
tggtttcactctccgccaagcatcccgtcacaaatcgaagagtatctgaaggacccaagc
cagcctatcctagaggccctggacacagacacatcgccaacggatgatgcctgggactcg
gtgtccatcgtttcgtttccagagaaggagcaagaagatgttccccaaagcactttgacc
caaaactctgctgcggtctgctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155707
Entry
111155707         CDS       T05871                                 

Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155707
   04151 PI3K-Akt signaling pathway
    111155707
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111155707
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111155707
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111155707
   04621 NOD-like receptor signaling pathway
    111155707
   04650 Natural killer cell mediated cytotoxicity
    111155707
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111155707
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155707
  09172 Infectious disease: viral
   05161 Hepatitis B
    111155707
   05160 Hepatitis C
    111155707
   05171 Coronavirus disease - COVID-19
    111155707
   05164 Influenza A
    111155707
   05162 Measles
    111155707
   05168 Herpes simplex virus 1 infection
    111155707
   05167 Kaposi sarcoma-associated herpesvirus infection
    111155707
   05169 Epstein-Barr virus infection
    111155707
   05165 Human papillomavirus infection
    111155707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111155707
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IFN receptor family
   111155707
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 111155707
NCBI-ProteinID: XP_022371732
UniProt: A0A2Y9KD72
LinkDB
Position
Unknown
AA seq 560 aa
MLALLGATTLVLVAGVPWMLPAAAGGTNLKSPQNVEVCIIDDTFILRWNRSSPSVRNVTF
SADYQILENGAWLQLPGCQSVASTECNFSSVKLNVYEEIKLRIRAEEGNNTSPWRYVDSF
TLFEKAQIGPPKVHLEAEDKAIIINISPPGTKDGGMWASDSSGFIYSLDIWKNSSSGERK
TKTVYSRDKIYELSPETTYCLKVKARLLPRKTGAYSPVYCIKTTVENKLPPPENIRVDAK
NQTYILKWDYAQENVTFHAQWLHAYLKKIPGDNSGKWKQIPNCKNIRTTQCVFPKNTFHK
GIYLIRVQASDGNTTSVWSHEEKFDTQLQITLFPPVITMKSTNNASLRVYISAPEESENK
PVNHLYPLIYEIVFWENTSNAERKILEKRTDFTFPQLKPLTVYCVKARALIQDERWNKSS
VFSDIVCEKTKPGNTSKTWLIAGVCAALFSIPVVIYVMKLLFRCISYVFFPSSKPPSTID
EYFSEQPLRNLLLFTSEELTERCFIIENTNTITAVEETNQTDGEHKKYSSQTSQDSGNYS
NEDESTGSKFSEEFLHQETE
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgctctcctgggcgcgacgaccctggtgttggtcgctggggtgccgtggatgctg
ccggcagccgcaggaggaacaaatctaaaatctcctcaaaatgttgaagtctgcatcatt
gatgatacctttatcctgaggtggaacaggagcagtccgtctgtcaggaatgtgactttt
tcagcagattatcaaatacttgaaaatggcgcttggctccaattgcctggctgtcagtct
gtggccagtaccgaatgcaacttttcttcagtcaagctcaatgtttatgaagaaattaaa
ctgcgaataagagcagaggagggcaacaacacttctccgtggcgttatgttgactcattc
acactgtttgaaaaagctcaaattggtcccccaaaagtacacttagaagccgaagataag
gcaataatcatcaacatctccccacctggaacaaaagatggtggcatgtgggcttctgat
agctcaggcttcatctacagcttagacatctggaagaattcttcaagtggagaaagaaag
actaaaactgtgtactccagagataaaatttatgaactctcaccagagaccacctactgt
ttaaaagttaaagcaagacttttgccaagaaaaactggtgcctatagtcccgtgtattgt
ataaagaccacagttgaaaataaactgcctccaccagaaaatattcgagttgatgctaaa
aatcaaacctatattcttaaatgggattacgcgcaggaaaatgtgacttttcacgctcag
tggctccatgcctatttaaaaaagattcctggggacaattcaggtaaatggaaacaaata
ccaaactgcaaaaatatccgaactacgcagtgtgtctttcccaaaaatactttccataaa
ggaatttaccttatccgtgttcaagcatcggatggaaataccacatcggtttggtctcac
gaagaaaaatttgatactcaattacaaattaccctgtttcctccggtcattaccatgaaa
tccactaacaatgcttccctgcgggtctatatcagcgctccagaagagtcggaaaataaa
cctgtgaaccatctttacccgctaatttatgaaattgtattttgggaaaacacttcaaat
gctgagagaaaaattctagagaaaagaactgattttacttttcctcaattgaaaccactg
actgtatattgcgtcaaagcccgagcactcattcaggatgaaaggtggaataaaagcagt
gtttttagtgatattgtgtgcgagaaaacaaaaccaggaaacacttccaaaacctggctc
atagctggagtttgtgctgcgctgttttccatcccggttgtcatctatgtcatgaaactt
ctctttcgatgtatcagttatgtgttctttccatcaagtaaacctccttccactatagat
gagtatttctctgagcaaccgctccggaacctcctccttttcacttccgaggaactgacg
gaaagatgttttataattgaaaacacaaacactatcacggcagtagaagagactaaccaa
actgatggagagcacaaaaaatacagttcccaaaccagtcaggattcggggaactattct
aatgaagatgaaagcactggaagcaaattcagcgaagagttcctgcatcaggaaaccgag
tga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155723
Entry
111155723         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155723
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111155723
   04061 Viral protein interaction with cytokine and cytokine receptor
    111155723
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111155723
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111155723
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111155723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111155723
   04090 CD molecules [BR:elk04090]
    111155723
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL10/28 receptor family
   111155723
CD molecules [BR:elk04090]
 Proteins
  111155723
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 111155723
NCBI-ProteinID: XP_022371773
UniProt: A0A2Y9KF39
LinkDB
Position
Unknown
AA seq 351 aa
MPRSLRSWLGGCLLMSALGMVPPPENVRMKSVNFKNILQWELPAFPKGNLTFTAQYHSYK
KFQAMCTRTALTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPLDDTMIGPPEMQV
EVLANSLHMRFLAPKMENEPETWTMRNIYNSWVYNVQYWKNSSDEKWPMTCQYDFEVLRD
LEPWTTYCVRVQGFLPDRNKTGEWSQPVCERTADDETAPPWTVAVVLAASLCAALLLLGC
SALLWCLYKKTKHAFCPGNCLPQHLKEFLGHPPHSTLLFFSFPPADEVFDKLSVLTQVPD
NSRQNPGDGSTPGAPSGQGSSELVPEEGVHTKGYSTPXLLSPTCEGQRETT
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgccgcggagcctgcggagctggctgggcggctgcctccttatgtcagcattaggaatg
gtgccacctcctgaaaacgtcagaatgaagtcagttaatttcaagaacattctacagtgg
gagttgcctgcttttcccaaagggaatctgactttcacagctcagtaccacagttataag
aaattccaagctatgtgcacgaggactgccttgacggaatgtgatttctcaagtctttcc
aagtatggtgatcacaccttgagagtcagggctgaatttgccgatgagcattctgactgg
gtaaacatcaccttctgtccgttggatgacaccatgatcggaccacctgaaatgcaagta
gaagtacttgctaattctttacacatgcgtttcttagcccctaaaatggagaatgagcct
gaaacatggacaatgaggaatatttataactcatgggtttataacgtgcaatattggaaa
aatagttctgatgaaaagtggccaatgacctgtcaatatgactttgaggtcctcagagat
cttgagccatggacaacttactgtgttcgagttcaagggtttcttcctgatcggaacaaa
actggggaatggagccagcctgtgtgtgagcgaacagccgacgacgagacagccccaccc
tggactgtggccgtggtcctggcagcgtccttgtgcgcagcccttttgctgcttggctgc
tcggccctgctgtggtgtttgtacaagaagaccaaacacgccttctgcccggggaactgc
ctgccgcagcacctgaaagagtttttaggccaccctcctcacagtacgcttctgtttttc
tccttcccgcccgctgatgaagtctttgacaagctgagtgtccttacacaagtccccgac
aacagcaggcagaatcctggcgatggcagcacccccggggccccatctgggcaggggtcc
tccgagctggtccccgaggagggagtgcacaccaaggggtacagcacccccntccttctc
tcgcccacctgtgagggtcagcgggaaaccacctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156295
Entry
111156295         CDS       T05871                                 

Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156295
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156295
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111156295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111156295
   04090 CD molecules [BR:elk04090]
    111156295
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111156295
CD molecules [BR:elk04090]
 Proteins
  111156295
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 111156295
NCBI-ProteinID: XP_022372783
UniProt: A0A2Y9KI44
LinkDB
Position
Unknown
AA seq 558 aa
MGVRWEEVKGRKHVRWSWESLSIDVGHLVLCLPKSDTLGFISETVNDVDHGEHAPQGAAL
LGRPPGDSPTGVLSAQSLAGRKALTRELSAWLLICACMGAWVGAAVSVQGEGGLGAGSVT
CLNNNILRIHCRWSAPEPGWGPHAWLLFTSNHAPGGRHRCVFRAGECTLVLPPEEVLVPS
DNFTITLHRGVSGQEQVSLVDPQYLPRRHVKLDPPSDLQSNVTSHYCVLTWRVSPALEPL
TAILSYELAFKKQEEAWEQARLRDRIVGVTRLSLDAVELDPGSRYEARLRVRMATPEMDV
EEELRYEGQWSEWSRSARFPSPQSPARGPLSSSWGQPSSSTLVAVPVFLLLTSLTYLVFK
LSPRVKRSLSWNVPSPAAFFQSLYSVHHGDFQTWTGAHRTGVLPSGDSGRSPRGASESGV
HEDIAWLTYDPVDPWQSVVLEEEQEGPGAGLLEAALLAGPVVQGGQPPAYLPQEDWAPTC
PLRPAPPPSNGGSGDYWTLGCSGGCQSPTFPGNSPSAGPSPALARGPSCNQQSLDARPGS
SAVGASHGERQDPAARVV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgggtgtgcgctgggaggaggttaagggaagaaaacacgtgcgttggtcctgggagtcc
ctgtccatcgacgtgggtcacctggttctgtgtcttcctaagtccgatactcttgggttc
atctcggaaactgtgaacgatgtagaccacggggagcatgccccacagggagcggccctc
ctggggagacctcctggggacagtcccacgggggtgctctcagcccagtcccttgcagga
cggaaggccctgacgcgagagctgagcgcctggctgctgatttgcgcctgcatgggcgcc
tgggtcggcgcggccgtctccgtccaaggggaaggagggctcggggccgggtctgtcacc
tgtctgaacaacaacatcctgaggatccactgccgctggtcggccccggagccgggctgg
ggcccccatgcctggctgctcttcaccagcaaccacgcaccgggtggccggcacagatgt
gtcttccgggccggggagtgcaccctggtgctgccccccgaggaggtgctcgtgccttcc
gacaacttcaccatcacgctgcaccgcggcgtctctgggcaggagcaggtcagcctggtg
gacccgcagtacctgcctcggagacatgtgaagttggaccctccctctgacttacagagc
aacgtcacctctcactattgtgtcctgacttggagggtcagccctgctctggagcccctg
accgccatcctcagctacgagctggccttcaagaagcaggaagaagcctgggagcaggcc
cggctcagggaccgcatcgtcggggtgacccggctctcgctggatgctgtggagctggac
cccgggtcccgctatgaggcccggctgcgggtccgcatggccaccccggagatggacgtg
gaggaggagctgcgctacgagggccagtggagcgagtggagtcggtctgcgcgcttcccc
tcaccccagagccctgcccgaggccccctgtcctcctcttgggggcagcccagcagcagc
accctcgttgctgtgcccgtctttctgctgctgaccagcctgacctacctcgtgttcaag
ctttcacccagggtgaaaaggagcctctcctggaacgtgccctctccggcggccttcttc
cagtccctctacagtgtgcaccacggggacttccagacctggacaggggcccacagaacc
ggcgtcctgccgagcggggacagtggccgttccccacgaggagcctcggagtctggcgtc
catgaggacatcgcgtggctgacctatgacccggtggacccctggcagtccgtggtcctg
gaggaggagcaggagggccctggggccggcctcctggaggctgcgctgctggccgggcct
gtggtccagggaggccagccgcccgcctacctgccgcaggaggactgggcccccacatgt
cccctcaggccagcccccccaccgtcaaatggcggcagcggcgactactggaccctgggc
tgctccgggggttgccaatcccccaccttcccaggaaactcaccgagtgcagggcccagc
ccggctttggcccggggcccttcctgtaaccagcagagcctggacgcccggccaggaagt
agtgctgtgggagccagtcacggcgagcggcaagaccccgctgcacgggtcgtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156948
Entry
111156948         CDS       T05871                                 

Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156948
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156948
   04061 Viral protein interaction with cytokine and cytokine receptor
    111156948
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111156948
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111156948
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156948
   05203 Viral carcinogenesis
    111156948
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111156948
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111156948
   04090 CD molecules [BR:elk04090]
    111156948
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111156948
CD molecules [BR:elk04090]
 Proteins
  111156948
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 111156948
NCBI-ProteinID: XP_022373828
UniProt: A0A2Y9KL32
LinkDB
Position
Unknown
AA seq 918 aa
MLTLQTWIVHALFIFFTTESVGELLEPCGYIKPESPVVQLGSNFTAVCVLKEKCMDYFHV
NASYIFWKTNHLTVPKEQYATINKTASSITFTDTSSLNTQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNFTLKSEWATEKFADCKTKRDTPT
SCTVDYSPVYFVNTEVWVEAENALGRVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIQDFIRLKYNIQYRTRDASVWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGYRSVQLIWKTLPPFEAN
GKILDYEVTLTRWKSRLQNYTVNETKWTVNITNDRYIATLTARNLVGKSDAAVLTIPAYD
FKATCPVRNLKAFPKDNMLWVEWTAPNESVNKYILEWCVLSDKSPCIPDWQQEDGLVHRT
YLRGNLAESKCYLITVIPVFADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKRHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDHMYSDGNFTDVSVVEIEAANDKKPFPEDLKSMDLFKKEKI
STEGHSSGIGGSSCMSSSRPSISSSDENESTQNTSGTVQYSTVVHSGYRHQVPSVQVFSR
SESTQPLLDSEERPEDLQLVDNTEGSAGSFPRQQYFKQNCSPRDTSPDISHFERSKQVSS
VNEEDFVRLKQQISDISQPFEAGQMKMFHEISVADAFGPHTDGLVERLETVGMEAAIDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgcaaacttggatagtgcacgcattgtttattttcttcaccactgaatct
gtaggtgaacttctagagccatgtggttatatcaaaccggaatctccagttgtacagctt
ggttctaatttcactgcagtctgtgtgctaaaagaaaaatgtatggattatttccatgta
aatgctagttacattttctggaaaacaaaccatctgactgttcctaaagaacaatatgcc
accataaacaaaacagcatctagtatcacatttacagatacatcttcattaaatactcag
ctgacttgcaacattcgtacatttggacaaattgatcagaatgtttatggaatcagaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacgaacttcacttta
aaatccgaatgggcaacagagaagtttgctgattgtaaaacaaaacgtgacacccccacc
tcatgcactgttgattattctcctgtgtattttgtcaacactgaagtctgggtagaagca
gagaatgcccttgggagagttacatcagatcatataaattttgatcctgtagataaagtg
aagcccaatccgccacataatttatccgtaagcaactcagaggaactgtccagtatctta
aaattgacatggatcaactcaagtatccaggattttataagactgaaatacaacattcag
tataggaccagagatgcctcagtttggagccagattcctcctgaagatacagcatccact
cgatcttccttcactgtccaggaccttaaaccttttacagaatatgtattcaggattcgt
tgtatgaaggaagatggtaaaggcttctggagtgactggagtgaagaagcaagtggtatc
acatatgaagatagaccatccaaggcaccaagtttctggtataagatagagccatcccat
actcatggctatagatctgtacaactcatatggaagacattgcctccttttgaagccaat
ggaaaaattttggattatgaagtgactctcacaagatggaaatcacgtttacagaattac
acagttaatgaaaccaaatggacagtaaacatcacaaatgatcgttacatagcaactctc
acagcgaggaatctggttggcaaatcagatgcagctgttttaactatccctgcttatgac
tttaaagctacttgccctgtaaggaatcttaaagcatttcccaaagataatatgctatgg
gtggaatggactgctccaaatgaatctgtaaacaaatacatccttgagtggtgtgtatta
tcagataaatcgccctgtatcccagactggcaacaggaggatggattagtacaccgcacc
tatttaagagggaacctagcagagagcaaatgttacttgataacagttattccagtattt
gctgatggaccaggaagccccgagtctataaaagcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatgggtttatccgaaattatactatattttatagaacc
atcattggaaatgaaaccgctgtgaatgtggattcttctcacacagaatatacattgtcc
tctttgaccagtgacactttgtacatggtacgaatggcagcatacacagatgaaggtgga
aaggatggcccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagcc
atagttgtgcctgtttgcttagcgttcctattgacaacccttttgggagtactgttctgc
tttaataagcgagacctaattaaaaggcatatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcatacacctcctaggcataattttaattcaaaagat
catatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcagcaaat
gacaaaaagccttttccagaagatctgaaatcaatggacctgttcaagaaggaaaaaatt
agtactgaaggacacagcagtggtattggagggtcttcatgcatgtcctcctctaggcca
agcatttctagcagcgatgaaaatgagtctacacaaaacacttcgggcaccgtccagtat
tccacagtggtgcacagtggctacagacaccaggttccatcggtccaagtcttctcaaga
tctgagtccacccagcccttgttagattctgaggagcggcctgaagatctacaactggta
gataacacagagggcagtgctggcagttttcccaggcaacagtatttcaaacaaaactgc
agtccgcgtgacaccagcccagatatttcacattttgaaaggtcaaagcaagtttcatca
gtcaatgaagaagattttgtgagactcaaacagcagatatcagatatttcacagcccttt
gaagctgggcaaatgaaaatgtttcacgaaatttctgtagcagatgcttttggcccacat
actgatggactggtagagcgattagaaaccgtggggatggaggctgcaattgatgaagga
atgcctaaaagttacctaccacagactgtccgacgaggtggctacatgcctcagtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157042
Entry
111157042         CDS       T05871                                 

Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04520  Adherens junction
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111157042
   04012 ErbB signaling pathway
    111157042
   04014 Ras signaling pathway
    111157042
   04015 Rap1 signaling pathway
    111157042
   04630 JAK-STAT signaling pathway
    111157042
   04066 HIF-1 signaling pathway
    111157042
   04068 FoxO signaling pathway
    111157042
   04020 Calcium signaling pathway
    111157042
   04072 Phospholipase D signaling pathway
    111157042
   04151 PI3K-Akt signaling pathway
    111157042
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111157042
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111157042
   04520 Adherens junction
    111157042
   04540 Gap junction
    111157042
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111157042
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111157042
   04915 Estrogen signaling pathway
    111157042
   04921 Oxytocin signaling pathway
    111157042
   04926 Relaxin signaling pathway
    111157042
   04928 Parathyroid hormone synthesis, secretion and action
    111157042
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157042
   05206 MicroRNAs in cancer
    111157042
   05205 Proteoglycans in cancer
    111157042
   05230 Central carbon metabolism in cancer
    111157042
   05231 Choline metabolism in cancer
    111157042
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111157042
  09162 Cancer: specific types
   05210 Colorectal cancer
    111157042
   05212 Pancreatic cancer
    111157042
   05225 Hepatocellular carcinoma
    111157042
   05226 Gastric cancer
    111157042
   05214 Glioma
    111157042
   05218 Melanoma
    111157042
   05219 Bladder cancer
    111157042
   05215 Prostate cancer
    111157042
   05213 Endometrial cancer
    111157042
   05224 Breast cancer
    111157042
   05223 Non-small cell lung cancer
    111157042
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157042
  09172 Infectious disease: viral
   05160 Hepatitis C
    111157042
   05171 Coronavirus disease - COVID-19
    111157042
   05163 Human cytomegalovirus infection
    111157042
   05165 Human papillomavirus infection
    111157042
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111157042
   01522 Endocrine resistance
    111157042
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111157042
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111157042
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111157042
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111157042
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111157042
  Exosomal proteins of pancreatic cancer cells
   111157042
  Exosomal proteins of bladder cancer cells
   111157042
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 111157042
NCBI-ProteinID: XP_022373961
UniProt: A0A2Y9KK28
LinkDB
Position
Unknown
AA seq 1154 aa
MFNNCEVVLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLY
ENTHALSVLSNYGTNKTGLQELPLRNLHEILQGAVRFSNNPVLCNVDSIKWQDIVDDSFV
SNMSMDFQNHAGNCQKCDPSCPNGSCWGPGKENCQKLTKIICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDETTCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTRTLPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNKKLCYAN
TINWKKLFGTSSQKTKIINNKDEKGCKAMGHVCHPLCSSEGCWGPEPEDCVSCRNVSRGK
ECVEKCNVLEGEPREFVENSECIQCHPECLPQPMNVTCTGRGPDSCVKCAHYIDGPHCVK
TCPAGIMGENNTLVWKFADANRVCHLCHSNCTYGCDGPGLEGCTIEGHKIPSIAIGIVGG
LFLVVMVALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDA
DEYLIPQQGFFHSPSTSRTPLLSSLSATSNNSTVACIDRNGSYPLKEDSFLQRYSSDPTG
TLTEDNIDDTFLPAPEYINQSIPKRPAGSVQNPVYHNQPLNPAPGRDAHYQNPHSNAVDN
PEYLNTIPPCVTSALGGPGLWAQKGNPQVSLDNPDYQQHFFPKEAKSNGVFKGPAAENAD
YLRVAPPSREFIGA
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatctggaaattacctacatgcaaaagaat
tatgacctttccttcttaaagaccatccaggaggttgccggctatgtcctcattgccctg
aacaccgtggagaagattcccttggaaaacctgcagatcatccgaggaaacgtgctctat
gaaaacactcatgccttgtccgtcttatccaactacggcacgaacaaaaccgggctgcag
gagcttcccctgagaaacttacacgaaatcctccaaggcgctgtgcgcttcagcaacaac
cctgtcctctgcaacgtggacagcatcaagtggcaggacatcgtggacgacagttttgta
agcaacatgtcgatggacttccagaaccatgcgggcaattgccaaaagtgtgatccgagc
tgtcccaatggaagttgttggggtccaggaaaagagaattgccagaaattgaccaaaatc
atctgtgcccagcagtgttcggggcgctgccgcggcaggtcccccagcgactgctgtcac
aaccagtgtgccgccggctgcacggggccccgcgagagtgactgtctggtgtgccgcaag
ttccgcgacgaaaccacgtgcaaggacacctgcccgccgctcatgctctacaacccgacc
acctaccagatggacgtcaacccagagggaaaatacagctttggcgccacctgcgtgaag
aagtgcccccgtaactacgtggtgaccgaccacggctcgtgtgtccgtgcctgcagctcc
gacagctacgaggtagaggaagatggagtccgcaagtgtaagaagtgtgaggggccttgc
cgcaaagtgtgtaatggaataggcattggcgaatttaaagacacactttccataaatgct
acaaatattaaacacttcaaaaattgcacgtcaatcagcggagatcttcatatcctgcct
gtagcgtttagaggtgactccttcacgcgtactctgcctctcgatccaaaggaactggac
attctaaaaactgtaaaggaaataacagggtttctgctgattcaggcctggcccgaaaac
aggactgacctccatgctttcgagaacctagaaatcatacgtggaagaacaaagcaacat
ggtcagttttctcttgcggtcgtcggcctggacataacgtccttgggcttacgctccctc
aaggagataagtgatggggatgtgatcatctcgggaaacaaaaaattgtgctatgcaaat
acaataaactggaaaaagctatttgggacttcaagtcagaaaaccaaaattataaacaac
aaagatgaaaaaggctgcaaggccatgggccacgtctgccatcctttgtgctcctcagag
ggctgctggggcccagagccggaagactgtgtgtcctgccgaaacgtcagccggggcaag
gaatgtgtggagaagtgcaatgttctggagggggagccaagggagtttgtggagaactcc
gagtgcatacagtgccacccggaatgcctgccccagcccatgaatgtaacctgcacggga
cggggaccggacagctgcgtcaagtgtgcgcactacatcgacggcccgcactgcgtcaag
acctgtccggctggcatcatgggagagaacaacaccctggtctggaagtttgcagatgcc
aatcgcgtgtgccacctgtgtcattccaactgtacctacggctgtgacgggccaggtctt
gaaggctgcacgatagaagggcacaagatcccatccattgccattgggattgtgggcggc
ctcttcttggtggtgatggtggccctcggggtgggcctctttttgcgccggcgccatatt
gtccggaagcgtacccttcgtagactcctgcaagaaagagagcttgttgagcctcttacg
cccagcggagaagctcccaaccaagctctcttgaggatcttaaaggaaacagaattcaaa
aagatcaaggtgctgggctctggagcatttggcacggtgtacaagggactctggatccca
gaaggtgagaaagttaaaattcctgtggccatcaaggaattaagagaagccacatctccg
aaagccaacaaggaaattcttgatgaagcctatgtgatggccagtgtggacaatcctcat
gtctgccgcctcctgggcatctgcctcacctccacggtccagctgatcacacagctcatg
ccctttggctgcctcctggactacgtccgcgagcacaaggacaacatcggctcccagtac
ctgctcaactggtgtgtgcagattgcaaagggcatgaactacctagaggaccggcgcttg
gtgcaccgcgacctggcagccagaaatgtcctggtgaagacaccacagcacgtcaagatc
acagattttgggctggccaagctgcttggtgccgaggagaaagaataccatgcagaagga
ggcaaggtgcctatcaagtggatggctttggaatcaattttacaccgaatttatacccac
caaagtgatgtgtggagctacggcgtcaccgtttgggagttgatgaccttcgggtccaag
ccttatgacggaatccccgccagcgagatctccaccatcctggaaaaaggagagcgcctc
ccgcagccacccatatgcaccatcgatgtctacatgatcatggtcaagtgctggatgata
gatgctgacagtcgtcccaaattccgtgaactgattattgaattctccaaaatggcccga
gacccccagcgctaccttgtcatccagggagatgagagaatgcacttgccgagccctaca
gactccaatttttaccgcgcactgatggacgaagaggacatggaggacgtggtggacgcc
gatgagtacctcatcccccagcagggcttcttccacagcccctccacgtcccggaccccc
ctcctgagctctctgagcgccaccagcaacaactccaccgtggcttgcattgacagaaac
gggagctatcccctcaaagaagacagcttcctgcagcggtacagctcagaccccacgggc
actttgactgaggacaacatagatgacacttttctcccagcacccgaatacataaaccag
tccatccccaagaggccggcgggttctgtgcagaatcctgtctatcacaatcagcctcta
aaccccgctcctggcagagacgctcactaccaaaacccccacagcaacgccgtggacaac
cctgagtatctcaacaccatccctccctgcgtcaccagcgcactcggcggccccggcctc
tgggcccagaaaggcaacccccaggtcagcctggacaaccccgactaccagcagcacttc
tttcccaaggaagccaagtccaacggcgtcttcaagggccctgcggccgaaaacgcagac
tacctgcgggtagccccgccgagcagggagtttattggagcatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157114
Entry
111157114         CDS       T05871                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157114
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157114
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111157114
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157114
   04090 CD molecules [BR:elk04090]
    111157114
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157114
CD molecules [BR:elk04090]
 Proteins
  111157114
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 111157114
NCBI-ProteinID: XP_022374061
UniProt: A0A2Y9KKB6
LinkDB
Position
Unknown
AA seq 403 aa
MATMLGLVSFLVILNSACCGRAQLAGENRSPIKNMQLDSRKRMLTWNYIRNVSEQECLIS
TPPNSPTMPSFSTIQAPEVREDSTYFCIFRNRVLHRGANLTVRVTCDGAKFQEVVPFANP
GREGSGAVNFSCFIYNVRLMNCSWASGPRAPADVCYRLFWWASLHEDEAECVHYITDPTG
TRVGCHFDELGEPQGMDNYFFLLNGTSSETAIPFLDFVPFEARKIEKYDPPTNITIAHNT
SHHIIRWENPEMRYELSPQVLYYELDIQRPGSSEKVRHVFQRGQDANVYVVPRSAVRPDT
TLRVRVRYLRNELWSEWSPMLRLGLPEQDFHGALVGVLVAATAVPALVLVCFCKCRYSLF
PRIPQVKKELTGTLFSPEVSWDEGRPPPGSQEPEDVLIVEDLS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgaccatgctgggtcttgtgagctttctggtgatcctgaactcggcgtgctgcgga
cgagcacagctggcaggggagaatagatctcctattaaaaacatgcagctagattcaagg
aaaagaatgttaacctggaattacataagaaatgtgagtgagcaggaatgcctgatatct
acccctcccaactctcccaccatgcctagcttttccaccatacaagccccagaggtcaga
gaggacagcacgtacttctgcatcttccgaaaccgcgtgctgcataggggagccaacctg
accgtgagggtcacctgtgacggggccaaattccaggaagtcgtgccttttgcgaaccca
ggcagggaaggttccggcgccgtgaacttctcctgcttcatctacaacgtccgtctcatg
aactgcagctgggcgtccggcccccgagcccccgccgacgtctgctaccggctcttctgg
tgggcctccctgcacgaggacgaggcggagtgcgtgcattacatcacggaccccacgggg
acacgcgtgggctgccatttcgatgaactcggtgaaccccagggtatggataattacttc
ttcctactgaatgggaccagcagtgagaccgcaatcccgtttttggactttgttccattt
gaagcccgtaagatcgaaaagtacgaccccccaacaaacatcacgatcgcccacaacaca
tcgcatcacattatccggtgggagaaccccgagatgagatacgagctttcgcctcaagtc
ttgtattatgagctggacatccaaagaccaggaagctctgagaaggttcgtcatgttttc
cagaggggacaagacgcgaatgtgtacgtggtgccgcgttctgccgtcaggccggacacc
acgctccgggtgagggtgcgctatctgcgtaatgagctctggagcgagtggagcccaatg
ctgcgtctcggcctcccggagcaggatttccacggcgccctggtcggggtgctggtggcg
gccacggcggtgcccgcgctggtcctcgtgtgcttctgcaaatgcaggtacagtctgttc
ccccgcatcccgcaggtgaagaaggaactcaccgggaccctgttctccccggaggtctcc
tgggacgagggccgccctccgccaggctcccaggagcccgaggacgtcctcatcgtggag
gacctgtcgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157141
Entry
111157141         CDS       T05871                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157141
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157141
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111157141
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157141
   04090 CD molecules [BR:elk04090]
    111157141
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157141
CD molecules [BR:elk04090]
 Proteins
  111157141
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 111157141
NCBI-ProteinID: XP_022374104
UniProt: A0A2Y9KS44
LinkDB
Position
Unknown
AA seq 439 aa
MSERRETEKENRWPEQSPVRWGFPHPSGNPMRVLAITILFFMLLDPVFLQTLEQQDISTA
ERVPRLNMKFDSWRMKLSWDCEENTTYLECVMFHKENGPINIIPQEKECHCEFSDYSLHD
GVTLMVKVNSTQRPIPETLVYANSGGNDTAAQNFSCFIYNANFMNCSWAKGQAAPDDVQY
FLYIRDSRKRRERECPHYIEDSGTHVGCHLEDLSGLTSYNYFLVNGTSQRTGIQFFDSVL
SWKKIEIYSPPNNISVLCNKSHCLICWEKPKTRYRLSNMEFKYQLDIQRKSNKENSENQL
IEVPGNLENSYNFPSPEPRPKHTVKIRTSDARIQKWGAWSQPIEFGSEETTPSLVPIYVL
VVLGTLITVLTLGCLLKRFLASQTLFPPIPRIKDKWTDNHRPDHQIIWENFTLDTEKGDN
EDILTVQEVTVAPASMEAA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcagagcgccgggaaaccgagaaagaaaacaggtggccagagcagagcccggtgcgg
tggggttttcctcatccttcgggcaaccccatgcgagtcttggccataaccatcctgttc
ttcatgctgcttgacccagtgttcctccagactctggagcagcaggatatttcaactgca
gaaagggtcccccgtctaaatatgaagtttgattcttggagaatgaaactgagttgggac
tgcgaagaaaacactacctacctcgaatgtgtgatgtttcacaaggagaatggaccaatc
aacataataccccaggagaaagaatgtcactgcgagttttcggattattctctccatgat
ggagtcacgcttatggttaaagtaaatagcacccaaagaccgattccagaaacactggtc
tacgctaactcaggtgggaatgacacagctgcccagaatttctcctgctttatctacaat
gcaaacttcatgaactgcagttgggcaaagggtcaggctgcccctgatgatgtccaatat
tttttgtatataagagactcgaggaaaagaagggaaagagagtgtcctcattacatagaa
gactcgggaacccatgtgggatgtcacctggaagacctctcgggattaactagctacaat
tacttcctggtgaacggtaccagccaaaggacggggatccagttctttgattcggttctg
tcatggaagaaaatcgaaatatatagcccacctaacaacatcagcgtgctctgcaacaag
tcccactgcctgatctgttgggaaaagcccaagacccgatacaggctgtccaacatggag
ttcaaataccagctggacatccagagaaagagcaataaggaaaacagcgagaatcaactg
attgaggtgcctggtaatttggagaatagctacaactttccaagtccggagcctagaccc
aagcatactgtgaaaataaggacctcggacgcacggatccagaagtggggtgcctggagc
cagcccattgagtttggctccgaggaaaccacgcccagcctcgtgcccatctacgtgctg
gtggtcctggggaccctcatcacggtcctgaccctcggctgccttttgaaaaggttcctc
gcatcccagactttattcccaccaattccgcgcatcaaagacaagtggacggataaccat
cggcctgaccaccagatcatctgggagaacttcaccttggacacggaaaaaggtgacaac
gaggacatcctaacagtgcaggaagtcacagtggccccggcgagcatggaagctgcatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157156
Entry
111157156         CDS       T05871                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157156
   04151 PI3K-Akt signaling pathway
    111157156
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157156
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111157156
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111157156
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157156
   04090 CD molecules [BR:elk04090]
    111157156
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157156
CD molecules [BR:elk04090]
 Proteins
  111157156
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 111157156
NCBI-ProteinID: XP_022374132
UniProt: A0A2Y9KJR4
LinkDB
Position
Unknown
AA seq 408 aa
MALLWLAVLLTSASSLPQSQEGRTEPQCVLRVCPAFCCFRETRRPDRYGSSGSDRYSPIK
NLRIEPVERRLTWDLHGNVSEIMCFINSKFITKAINNNRYCQFHILPSCEVKNFSVSLTK
GPPFSVGIQYPLQEGNPGAAAQGLDCRVHDVDFLTCSWEVGREAPRDIQYHLYWQDLRTQ
REYECPNYEMDNRGKLVRCHFNDVSRLPKLLQILVRGTSPGVRIPCSDRTVELSEIEILN
PPTITAMCNKSSLMMEWEACSHFNNRFEYELQLQKGSDPAYTEKLQEKFFELHNPRNYVA
RLRAKGFYRKSWSEWSAPQRFACDVGEDSQRPDWLLSALVLLATLLVLGLVIALCGRYSV
LQKLFPPIPHMRDPITDNLQSSKLVAWEGSRASREDCPVAEVQVLGET
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgccgtgcttctgacgtctgcgtccagcctgccgcaatcacag
gaaggtaggaccgaaccccagtgcgttctgagggtgtgtccggcgttctgctgtttccgt
gaaactcgacgtccagatcggtacggatccagcggcagcgatcgctattcaccgattaag
aacctaaggatagagccggtggaaaggagattgacctgggacctccatggaaatgtttct
gaaattatgtgtttcataaattcgaaatttatcactaaggccatcaacaacaaccgttac
tgccagttccacatccttccctcgtgtgaagtgaaaaacttcagtgtctccttgaccaaa
ggcccgccattctcggtggggattcagtatcctctgcaagaaggaaaccctggggcggcc
gcacaaggtctggactgccgggtgcacgacgtggacttcctgacgtgcagctgggaggtg
ggcagggaggccccccgggacatccagtatcacctatactggcaggatctgaggacccag
agggagtacgagtgcccaaattacgaaatggataatcggggaaaactcgtccggtgtcat
ttcaatgatgtctccagattgccgaaactcctccagatcctggtgaggggcacaagccca
ggtgtcaggatcccctgctccgaccgtactgtcgaattatcagaaattgagatattaaat
ccacctactatcactgcaatgtgtaataaatcctctttgatgatggagtgggaagcgtgc
agccactttaataacagatttgagtatgaacttcagctacaaaagggcagtgatcccgcc
tacacggagaagctccaggaaaagttctttgagcttcacaatcccagaaactacgtggcg
agactaagggccaaaggtttctaccgcaaaagctggagcgagtggagtgccccccaacgc
ttcgcgtgcgatgtgggggaggactcgcagcggcccgactggctgctgtccgcgctggtc
ttgctggccacactgctggtcctggggctcgtgatcgcgctgtgtggaaggtactcagtg
ttgcagaagctctttcctcccatcccgcacatgagagaccccatcactgacaaccttcag
agcagcaagctggtggcctgggaaggcagcagggcaagccgggaggactgcccggtggcg
gaggtgcaggttttgggggagacatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157190
Entry
111157190         CDS       T05871                                 

Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157190
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157190
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111157190
SSDB
Motif
Pfam: Tissue_fac IL6Ra-bind
Other DBs
NCBI-GeneID: 111157190
NCBI-ProteinID: XP_022374187
UniProt: A0A2Y9KJW7
LinkDB
Position
Unknown
AA seq 370 aa
MRTVFLPWALAALFLLADVAVSEVSALEGALQLQIINFNFETVQVTWNASKDSGTNLTFL
YKLSSDETSSQCSNYILQQSHTAGCLLEAKKDEILCFSIWNATHLLLTKCQWISAYLKPS
SPKELNFQWHQEAITVTCSDLPYKRLLYEIQYKSMFDTEWQSKEGETCNVTTDGLDAEKC
YFFRARVKTMESSYGPDTYPSDWSEVTHQQRGELRDSCQEKKLFPKFVLISGMVALLTVF
LLLLSLWKVRRVQKLLMPMVPDPKFSFPGLFESHQGNFQEWIKDTQNMAHLSKMEGAEQE
CVPEEALVVHVVKNEAEMPIMTTSPLCPQTEEEEASGDPSQLPCQPLQGGEEISLGGFTF
VMSDNSYVML
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaggaccgtgtttctgccctgggcattggcagccctcttcctcctggccgatgtggcg
gtttcagaagtctcagcactggaaggagcattgcaacttcagattatcaactttaatttc
gaaaccgtgcaggtcacatggaatgccagcaaggactctgggacaaatttgactttcctc
tataagttaagcagtgatgagaccagtagccaatgctccaactatattcttcaacaaagt
cacactgccggatgcctcctggaggcaaaaaaagatgaaattctgtgcttttccatctgg
aatgcaacacatctccttctcaccaagtgccagtggatcagtgcttacttgaaacccagc
tccccgaaagagttgaacttccagtggcatcaggaagccatcacagtgacctgttctgat
ctcccctacaagcgtctcctctacgaaatccagtacaagagtatgttcgacactgagtgg
cagtccaaggagggagaaacctgcaatgttacgacagatggcttggatgctgagaaatgt
tatttcttcagggccagagtgaaaacgatggagtccagctatggccctgacacataccca
agtgactggtcagaagtgacacaccagcagaggggggagctgagagattcgtgccaggag
aaaaagcttttccccaaatttgttttaatttctggcatggttgctttgctgaccgtgttc
ctccttcttctgtctttatggaaagtacggagagttcagaagctcctcatgcccatggtg
cctgatcccaaattcagcttccctgggctctttgaatcccaccagggtaacttccaggag
tggataaaggacacccagaacatggcccacttgagtaagatggagggtgcagagcaagag
tgtgtcccagaagaggccctagttgtccacgtggtcaagaatgaggctgagatgcccatc
atgacgaccagcccactgtgcccacagacggaggaggaagaggcctccggggaccccagc
cagctcccttgccagcccctgcaaggtggtgaggagatttctctggggggctttacgttt
gtgatgagtgacaactcatatgtgatgttgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157297
Entry
111157297         CDS       T05871                                 

Definition
(RefSeq) interleukin-13 receptor subunit alpha-1 isoform X1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157297
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157297
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157297
   04090 CD molecules [BR:elk04090]
    111157297
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157297
CD molecules [BR:elk04090]
 Proteins
  111157297
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 Tissue_fac EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 111157297
NCBI-ProteinID: XP_022374313
UniProt: A0A2Y9KMI5
LinkDB
Position
Unknown
AA seq 421 aa
MARPARLCGLWALLLCAGGAAPTETQPPVTNLSVSVENLCTVIWTWDPPEGASPNCTLWY
FSHFDNKQDKKIAPQTHRSKEVPLNERICLQVGSQCSTSESDNPSILVEKCTPPPEGDPE
SAVTELQCVWHNLSYMKCTWLPGRNASPDTNYTLYYWHSSLGKILQCEDIYREDQHIGCS
FALTNLKDSNFEQHSVQIMVKDNAGKIRPSFNIVPLTSHVKPDPPHIKRLFFQNGNLYVQ
WKNPQNFYSRCLSYQVEVNNSQTETNDIFYVEEAKCQNSEFEGNLEGTICFMVPSVLPDT
LNTVRIRVRTNKFCYEDDKLWSNWSQAMSIGENTDPTFYISMLLATPVIVAGAIIILLLY
LKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTREETDSVVLIENLKRAS
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgcggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcgcc
gcgcccaccgaaacccagccacctgtgacgaatttgagtgtttctgttgaaaacctctgc
acggtcatatggacatgggatcctcctgaaggagccagcccgaattgcaccttatggtat
tttagtcactttgacaacaagcaggataagaaaattgctcctcaaacccatcgttccaaa
gaagtacccctgaacgagaggatttgtctgcaagtggggtcccagtgcagcaccagtgaa
agtgacaatcctagcattttggtggagaagtgcaccccgcccccggaaggtgatcccgag
tccgctgtgactgagctacaatgcgtctggcacaacctgagctacatgaagtgtacttgg
ctccctgggaggaatgcaagtcccgacaccaactataccctctactactggcacagcagc
ctgggaaaaattcttcagtgtgaagacatctatagggaagatcaacacattggttgttcc
tttgctctgactaatttgaaggattccaattttgagcaacacagtgtccaaataatggtc
aaggataatgcaggaaaaattagaccatccttcaatatagtgcctttaacttctcatgtg
aaacctgatcccccacatattaaacgtctgttcttccaaaatggtaacttgtatgtgcag
tggaagaatccacagaatttttacagcagatgcttatcttatcaagtagaagtcaataac
agccaaactgagacgaatgatattttctacgttgaagaggccaaatgtcagaattcagaa
tttgagggaaacctggagggtacaatttgtttcatggtccccagtgttcttcctgatact
ttgaacacagtcagaataagagtcaggacaaacaagttttgctatgaggatgacaaactc
tggagtaattggagtcaagcgatgagtataggtgagaataccgaccccacgttctacata
agcatgttgcttgccactccggtcatcgttgcaggcgccatcatcatccttctgctttat
ctcaaaaggctcaagatcattatattccctccaattcctgatcctggcaagatttttaaa
gaaatgtttggagaccagaacgatgataccctgcactggaagaagtacgacatctacgag
aagcaaaccagagaagagaccgactctgtggtactgatagaaaacctgaagagagcctct
cagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157480
Entry
111157480         CDS       T05871                                 

Definition
(RefSeq) cytokine receptor common subunit beta isoform X1
  KO
K04738  cytokine receptor common subunit beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157480
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157480
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111157480
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157480
   04090 CD molecules [BR:elk04090]
    111157480
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157480
CD molecules [BR:elk04090]
 Proteins
  111157480
SSDB
Motif
Pfam: IL4Ra_N IL6Ra-bind fn3 IL2RB_N1 EpoR_lig-bind Tissue_fac Interfer-bind Pur_ac_phosph_N RestrictionSfiI
Other DBs
NCBI-GeneID: 111157480
NCBI-ProteinID: XP_022374613
UniProt: A0A2Y9KNA8
LinkDB
Position
Unknown
AA seq 902 aa
MVVSQGLLPVVLLALFWGPSVAGAHETVPLQTLSCYNDYKSLITCRWANTQDAQGLINLT
LYRRLNEDPPKPVSCDLSNETALIDHPCPACVSRRCVIPYEFFVIADRDYFSFRPDRPLG
TQLTITLTQHVQAPAPKDLLINTTGERFLLTWTVALLDSQSHWLSNLEYEVVYKRLQDSW
EEASTLYLSSSQAVLESEHLIPSSTYVARVRTHLAPSSGLSGRPSQWSPEVRWHSQTGDK
AQPQNLQCFFDGAAVLSCSWEVRSEVANSVSFALFYKASPNAGEEECSPVLKEELPGLYV
QYRCQIAVPDPRKDSRYTISIRPKEEEKFIKSSENIQMAQPTLNVTKSRDGYTLHWTAQE
MFYKHIGHTFQVQYKKATASREESKTETLQNTHSMSLPPLEPSTRYQARVRVKPTPGGYD
GIWSEWSEELFWDTEWVLPMWVLVLILVFTTGALLPALRCCGMYGYRLNQKWEEKIPNPS
KSHLFQNGSAGLQLPGSISGLISRSPPHKEPQGSFILGLDSAFPVDYRHSEVSPLTTEDP
KDACESPSEPDTTPASLDPHSEEAPGPQLDPSAPAGRSESQASGYDFNGPYLGLPHSHSL
PDVLGQPAPPQAGLSQKPQPPGSLEYLCLPAGGQVQLVPLAQVMAQGQAMDREGSPDPGK
EGSPSLESRACPTPSAPGLMVGGQDPKNSPNPKDGTLAALPTGSGAHEDGLLASGYVTTT
DLALPLPTGLPSASTVHLLHLPTDQSHSLRPGVAGGSHAVPGPVKPEVEGYVDVPPTPGQ
SPKSPLGSPALPPASSPTLSPGEPRAEGVPPSPYPEGLLVLQQVGDYCFLPGLGSGLLSP
QTKPSSPGPYPEIGDPDQVSQAKKALGQAIPQMPAIRHFKALKQQDYLSLPPWDVGRPGE
VC
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggttgtgtcccagggcctgctccctgttgtcttgctggctctgttctgggggcccagc
gtggcaggggcccatgagactgtcccactgcagaccctgagctgctacaatgactacaag
agcctcatcacctgcaggtgggcaaacactcaggacgcccaggggctcatcaacctgact
ctctaccggaggctgaatgaggaccctccaaagccagtgtcctgtgatctcagtaacgag
acggccttgatagaccacccctgtcccgcctgtgtgtccagaagatgtgtcattccatat
gagtttttcgttattgctgacagagactacttctcattccgaccagaccggcccctgggc
acccagctcaccatcactctgacccagcatgtgcaggccccggcacccaaggacctcctg
atcaatactaccggggagcgcttcctgctgacctggacagtggcccttctggattcccag
agccactggctgtccaacctggagtatgaggtggtctacaagcggcttcaggactcctgg
gaggaggcctccaccctctacttgagctcctcccaggccgtcctggagtcagaacacctc
attcccagcagcacctacgtggcccgagtgcgcacccatctggcccccagctcagggctc
tcgggacggcccagccagtggagcccggaggtccgctggcactcgcagacaggggacaag
gcccagccccagaacctccagtgcttcttcgatggggccgccgtgctcagctgctcctgg
gaagtgaggtccgaggtggccaactcagtctccttcgccctcttctacaaggccagcccc
aacgcaggggaagaagagtgctccccagtactgaaggaggagctccctggcctctacgtc
cagtaccgatgccagattgccgtgcccgaccccaggaaggacagccggtacaccatctcc
attcggccaaaggaggaggagaagtttataaaaagctcggaaaacatccagatggctcag
ccgacactcaatgtgaccaaaagcagagatggctacaccctgcactggacggcacaggag
atgttctacaagcacataggtcacaccttccaggtccagtacaagaaggctacagcctca
agggaggagagcaagacagaaaccctccagaacacccacagcatgtcgctgccgccactg
gagccctccaccaggtaccaggcaagagtgagggtcaagcccacccccggcggctatgac
ggcatctggagtgagtggagtgaggagctcttctgggacactgaatgggtgctacccatg
tgggtcctggttctcatcctggtcttcaccactggggcactgctccctgccctgcgctgc
tgtggcatgtatgggtacaggctgaaccagaagtgggaggagaaaatccccaaccccagc
aagagccacctgttccagaacgggagtgccggcctccagctcccaggcagtatatcgggg
ctcatcagcaggagccccccgcataaggagccgcagggcagcttcatccttgggctggac
agcgcgttccctgtagactacagacacagcgaggtgtcgcctctcaccacggaggaccca
aaagatgcctgtgaatcaccatcagagcctgacacgactccagcctccttggacccgcac
tcggaggaggcccctggcccccagctagacccatcggcccccgcaggcaggtcggagagc
caggcttccggctacgacttcaatggcccctacctggggctcccccacagccactccctg
cctgatgtgctgggccagccggcacccccacaggcaggcctgagccagaagccgcagcct
ccggggtccctggagtacctgtgtctgcccgcaggggggcaggtgcagctggtcccgctc
gcccaggtgatggcccagggccaggccatggatcgggaggggagccctgacccgggcaag
gaggggagcccctccctggagtcaagggcatgccccaccccttcagcgcctgggttgatg
gtaggtggtcaagacccaaagaacagccccaacccgaaggatgggacacttgcagctctg
cccactggctctggggcccatgaggatggtcttctggcctctggctatgtcaccactaca
gacctagcactccccttgcccacggggctgccatctgcctccacagttcacctactgcac
ctgcccacagaccagagccacagcctccgtcctggagtggctggtgggtcccatgcagtc
ccaggccccgtgaagccagaagttgagggctatgtggatgtccctccaaccccaggccag
tctcctaagtcccctctgggcagtcctgcccttcctccagccagcagccccaccctaagc
ccaggggagcccagagcagagggggtgcccccctccccataccccgaggggctcctggtc
ctacagcaggtgggtgactactgcttcctccctggcctgggctctggtcttctctcaccc
cagacaaagccctcttccccaggaccctatcctgagatcggggaccccgaccaggtgtcc
caggccaagaaggccctgggccaggccattccccagatgccagccatccggcacttcaag
gccctcaagcagcaggactacctatcactaccgccctgggatgtcggcaggcctggggag
gtgtgctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157559
Entry
111157559         CDS       T05871                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157559
   04151 PI3K-Akt signaling pathway
    111157559
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157559
   04061 Viral protein interaction with cytokine and cytokine receptor
    111157559
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111157559
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111157559
   04659 Th17 cell differentiation
    111157559
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157559
   05202 Transcriptional misregulation in cancer
    111157559
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157559
   05162 Measles
    111157559
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157559
   04090 CD molecules [BR:elk04090]
    111157559
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111157559
CD molecules [BR:elk04090]
 Proteins
  111157559
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 111157559
NCBI-ProteinID: XP_022374779
UniProt: A0A2Y9KU48
LinkDB
Position
Unknown
AA seq 560 aa
MAAPALSCYLSLLVFLLALAIPQGFTAADADTPKLTCFYNSKANISCAWSWDGDPQASSC
KIHAWPDRRPWNRSCELLPLSPAFWVCHLILGSPDAQSLTAADIVKMSVICHEGGRWRTL
MTQDFKPFENLRLMAPDLLQITHVGTHKCNITWKVPQSSHYIESYLEFEARTRSPGHSWE
EASVLILRQNQQWICLETLTPGTLYEFQVRVRAHLGSHKAWSPWSQPLAFRTRPAGKRTL
TFPRFGHVVVGISSAFGFLILVYFLAKCQYIRLWLKKVLKCHIPDPSEFFSQLKSEHGGD
FQKWLSSPFPSSSFSPNTQAPEISPLEVLDRDTKATQLLLLQQKGPSPSAETSGHSLTSC
FTNQGYFFFHLPDALEIEACQVYFSYDPCTEESEEGGAGAPEGSLLPPLPPLPPLSSPPL
PAEDDAYCTFPPGDDLLLFSPGLLGGPVPPNTMAGGSGACEEKLPPSLWEGAPRDWAPQA
LVPPNPGVSDPGDSQPPLERALGEAREEVPAPGPTEGIGFPWARPPGYGQVGTPASCLTL
NTDAYVSLQELQEQDPAHLV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggcagcgccggctctgtcctgctatctgtccctccttgtcttcctcctggccctggcc
atccctcagggattcacagcggcagatgcagacacccccaagctcacatgcttctacaac
tcaaaagccaacatctcctgtgcctggagctgggatggggacccacaggcctcgtcctgc
aagatccatgcttggccagatagacggccttggaacaggtcctgcgagctgctcccactg
agcccggcgttctgggtctgtcacctgattcttggatccccagatgctcagagtctgact
gcggctgacattgtcaaaatgagcgtgatatgccacgaaggggggaggtggaggacactg
atgacccaggacttcaagccctttgagaaccttcgcctgatggcccccgacttgctccaa
atcacccatgtcgggacccacaaatgcaacataacctggaaagtcccgcagtcctcccat
tacattgaaagttacctggagtttgaggcccggacaaggtccccaggccacagctgggag
gaggcctccgtgctgatccttaggcaaaaccagcaatggatttgccttgagacacttact
ccgggcaccttgtatgaatttcaagtgcgggtcagggcccacctaggcagtcacaaggct
tggagtccctggagtcagcccttggccttcaggacgaggcctgcagggaagcggactctg
acctttcctcggtttggccatgtcgtcgtgggcattagcagtgccttcggctttctcatc
ttggtctactttttggccaaatgtcagtacatccgactgtggctgaagaaggttctgaag
tgccacatcccagacccgtcggagttcttttcccagctgaagtcagagcatggaggagat
ttccagaagtggctctcctcgcccttcccctcgtcatccttcagtcccaatacccaggca
cccgagatctccccgctggaggtgctggaccgggacaccaaggccacacagctgctcctg
ctgcagcagaaggggccctcaccctcggccgagaccagcggccactcgctgaccagctgc
tttaccaaccaaggttacttcttcttccacctccctgacgctctggagatcgaggcctgc
caggtgtacttcagctatgacccctgcacagaagagtccgaggagggcggggctggggcg
cctgaggggtctctcctcccacccctgccgcccctgccgcccctctcctcgccacccctg
ccagcagaagacgatgcctactgcaccttcccccctggggatgacctgcttctcttctct
cccgggctcctgggtggccccgtcccccccaacaccatggccgggggcagtggagcctgt
gaagagaagctgcccccctctctgtgggagggagctccccgagactgggccccccaggcc
ctggtgcctcccaacccaggagtgtctgacccgggggacagccagccaccgctggagcgc
gccctgggagaagcaagagaggaggtcccggcccctggccccacggaggggatcggcttc
ccctgggctagaccccccgggtatggccaggttggaacccctgcctcctgcctgaccctg
aacaccgatgcctatgtgtctctccaagagctgcaggagcaggacccggctcacttggtg
tag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158614
Entry
111158614         CDS       T05871                                 

Definition
(RefSeq) interleukin-15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04672  Intestinal immune network for IgA production
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111158614
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111158614
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111158614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158614
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111158614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111158614
   04090 CD molecules [BR:elk04090]
    111158614
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111158614
CD molecules [BR:elk04090]
 Proteins
  111158614
SSDB
Motif
Pfam: Sushi PRIMA1 7tm_1 Chordopox_A13L
Other DBs
NCBI-GeneID: 111158614
NCBI-ProteinID: XP_022376463
UniProt: A0A2Y9KTH5
LinkDB
Position
Unknown
AA seq 263 aa
MAAQSLAVLDGVTCPPPTSVEHADIRVKSYSLKSRERYTCNSGFKRKAGTSSLTQCVFNK
TTNIAHWTIPNLKCIRDPSLTHLRPSSTEVPAGVTPEPESTSLSGKEPNFTSKSDTTVAT
KSTMVPGSGLTPSKPPAAGTMGPISPEPSQAPPQTTAEALEHTPSASQETPGTYSYHSRS
MTEVIGSTLAVVCAVVVVIVVCYRKLRHTVQTPSVEMESMEEMPMTRGTNGREEDAENYP
HDLGHSRERLRAAEAEAKAPTLP
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctgcacagtccctagccgtgctggatggcgtcacatgccctcctcccacgtcggtc
gaacatgcagacatccgggtcaagagttacagcctgaaatcccgggagcggtacacgtgt
aactctggcttcaagcgtaaagcaggaacatccagcctgacgcaatgcgtgttcaacaag
accacgaacattgcccactggacaattcccaatctcaagtgcatcagagacccctctctg
actcacctaaggccatcctccacagaagtgccggcaggggtgaccccagagccagagagc
acctccctttctggaaaagagcccaatttcacttccaagtcagacaccacagtggccaca
aagtccactatggtgccgggctccgggctgacgccatcaaagcctcctgcggcaggaacc
atggggccgatcagtccggagccctcccaagccccacctcagacaacggcagaggccttg
gagcacactccctctgcctcccaggagacgccaggtacatattcataccactctcgaagt
atgactgaggtgatcgggagcacactcgccgtggtctgtgcagtggtggtggtaattgtg
gtctgttaccgaaaactgaggcacactgtgcagacacccagtgttgaaatggaaagcatg
gaagagatgccaatgactaggggaaccaatggcagagaggaggacgcagaaaactaccca
cacgacctaggacactccagggagagactgagggcagcagaggctgaagcgaaggcaccc
accctgccttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158621
Entry
111158621         CDS       T05871                                 

Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111158621
   04151 PI3K-Akt signaling pathway
    111158621
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111158621
   04061 Viral protein interaction with cytokine and cytokine receptor
    111158621
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111158621
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111158621
   04658 Th1 and Th2 cell differentiation
    111158621
   04659 Th17 cell differentiation
    111158621
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158621
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111158621
   05162 Measles
    111158621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111158621
   04090 CD molecules [BR:elk04090]
    111158621
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111158621
CD molecules [BR:elk04090]
 Proteins
  111158621
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 111158621
NCBI-ProteinID: XP_022376471
UniProt: A0A2Y9KRX7
LinkDB
Position
Unknown
AA seq 275 aa
MEPSLLMWGISTFITVSGHMTGLFFSADLCDDSPPSLKHAAYKALEYRTGTMLTCGCERG
FRRLNSVMRCAGNSSHASWQNKCQCVSTSSKRTERQVTPKPEEEKAMQSLTLPGDQGNLP
GHCREPPSWDHEDSERIYHFVVGQTVHYQCAPGFRALRRGSAQSVCKTVSGKTQWTRPQL
KCISDREDGQFPADDEDEPEASTLALPGRDTSRPLMTAGTTDSHKHTEVATTMESFLFTS
EYQIAVAGCVLLLVSVLLLSGLTWQRRWRKSRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggggaatctccaccttcatcacagtatctggccacatg
acaggcctctttttctcggcagacctttgtgatgacagcccgccgagcctcaagcacgcc
gcgtacaaagccctcgagtacaggaccggcacgatgctaacttgtggatgtgagagaggc
ttccgcaggctaaacagcgtcatgcgttgtgcaggaaactccagccacgcttcctggcag
aacaaatgccaatgcgtcagcacatcctccaagagaacagaaagacaagtcactcccaaa
cccgaggaagagaaggcaatgcagagcctaacgctgcccggggaccaagggaaccttcca
ggtcactgcagggagcctccttcctgggaccacgaagattcagagagaatctaccacttt
gtggtggggcagacggttcactaccagtgtgcgccgggattcagggccctgcggagaggt
tctgcccagagcgtctgcaaaaccgtctcagggaagacccagtggacgcggccccagctc
aagtgcataagtgacagagaggatggtcagttcccagcagatgacgaagacgagcctgaa
gcaagcaccctcgcgctccctgggagagacacttcccgtcccttgatgacagcaggtact
acagattcccacaagcacacagaagtggctaccacgatggagtccttcctgttcacctcc
gagtaccagatagcagtggccggctgtgttctcctcctggtcagcgtcctcctcctgagc
gggctcacctggcagcggagatggaggaagagcagaagaacaatctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160969
Entry
111160969         CDS       T05871                                 

Definition
(RefSeq) interleukin-13 receptor subunit alpha-2 isoform X1
  KO
K05077  interleukin 13 receptor alpha-2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111160969
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111160969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111160969
   04090 CD molecules [BR:elk04090]
    111160969
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111160969
CD molecules [BR:elk04090]
 Proteins
  111160969
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 111160969
NCBI-ProteinID: XP_022380085
UniProt: A0A2Y9LET7
LinkDB
Position
Unknown
AA seq 396 aa
MAFVHLDVRHFCTLLICTTFVSVPSNAEIKVNPPEDFEIVDPGYLGYLSLQWQRPLFLDN
FQDCPIEYELKYRNIGSKYWKTIITKNLHYKDGFDLNKGVEAKIHTLVPAQCTNGLEVRS
SWSEATYWTSPRGNEDTKVREMDCVYYNWQHLLCSWKPGVSAHLVTNYQLFYWFEGLKYA
IQCPDYIKANGKNTGCRFPHLESSDYKDFYICVNGSSESHPIQPSYFIFQLQNIVKPLPP
EYLSLTVENSEEVNLRWSMPKGPIPAKCFIYEIEFTEDDTTWVVRTLHLFGKNTTTVENE
IQITRTSNESKKLCFLVRSKINMYCSDDGLWSEWSDEQCWKGDKWKETVVFFLIPFAFIS
LFVLVITCLLLYNQRALLKTIFHAKKEVFSHQETFF
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctttcgttcatttggatgtgagacacttctgtaccctgcttatttgcacaacgttt
gtctctgtgccttcaaatgctgagataaaagttaatcctcctgaggattttgagatagtg
gaccctggatatttaggttatctgtctttgcaatggcaacgtccactgtttctggataat
tttcaagactgcccaatagaatatgaattaaaataccgaaacattggtagcaaatattgg
aagaccatcattaccaagaatctacattacaaagatgggtttgatcttaacaaaggtgtt
gaagcaaagatacacacacttgtgccagcacaatgcacaaatggattggaagttcgaagt
tcatggtcagaagctacttattggacatcaccaagaggaaacgaggataccaaagttcgg
gaaatggactgtgtatattacaactggcagcatttactctgttcttggaaacctggcgtg
agtgcccatttggttaccaattaccaattgttttactggtttgagggcttgaagtatgca
atacagtgccccgattacataaaggctaatggaaaaaatacaggttgcaggtttccccat
ttggagtcatcagactataaagatttctatatctgtgttaatggatcatcagaatcccat
cctatccaacccagctattttatttttcagcttcaaaatatagttaaacctttgccacca
gagtaccttagtcttaccgtggagaattcagaggaagttaacctgagatggagcatgcct
aaaggacccattccagccaaatgttttatttatgaaattgaattcaccgaagatgacact
acctgggtggtacgaacattgcatttgtttggaaaaaacactaccacagttgaaaatgag
atacaaatcacaagaacatcaaatgaaagtaaaaaattatgctttttggtaagaagtaaa
ataaatatgtattgctcagatgatggactctggagtgagtggagtgatgaacaatgttgg
aaaggtgacaaatggaaggaaaccgtagtattttttttgataccatttgcttttatctca
ctgtttgttttggtaataacttgtctgcttttgtataatcaaagggctttactgaaaacg
atctttcatgcaaaaaaagaagtcttttctcatcaggagacatttttttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161041
Entry
111161041         CDS       T05871                                 

Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
elk05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161041
   04151 PI3K-Akt signaling pathway
    111161041
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111161041
   04061 Viral protein interaction with cytokine and cytokine receptor
    111161041
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111161041
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111161041
   04659 Th17 cell differentiation
    111161041
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161041
  09163 Immune disease
   05321 Inflammatory bowel disease
    111161041
   05340 Primary immunodeficiency
    111161041
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161041
   05162 Measles
    111161041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111161041
   04090 CD molecules [BR:elk04090]
    111161041
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111161041
CD molecules [BR:elk04090]
 Proteins
  111161041
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 111161041
NCBI-ProteinID: XP_022380200
UniProt: A0A2Y9LF41
LinkDB
Position
Unknown
AA seq 374 aa
MLKPPLPLRSFLFLQLPLLGVGLNPTVPMPNGNEDVTAGFFPTATPPRTLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPSNLTLHYWYKNSNDDKVQECGHYLFSGGTTAGCWLQKE
EIHLYETFVVQLQDPQEPRRQSIRTLKLQNLVIPWAPENLTLRNLSESQLELSWSNRHLD
HCLEHLVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEW
SRPVHWGSNTSKENPWLFALEAVLIPLVSMGLIISLICVYCWLERTIPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAP
PCYTLKPETRALIP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccttcttattcctgcagctgcctctgctgggg
gtggggctgaacccaacggtccccatgcccaatgggaatgaagacgtcacagctggtttc
ttcccgactgctacacctcctaggaccctcagcgtttccaccctgcccctcccagaggtc
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
cagcccagcaacctgactctgcactactggtacaagaactccaatgatgataaagtccag
gagtgtggccactatctgttctctggagggaccactgctggctgttggctgcaaaaggag
gagatccatctctacgaaacatttgtggtccagctccaggacccacaggaacccaggaga
cagtccattcggacactaaaactgcagaatctggtgatcccctgggccccagagaacctg
acccttcgcaacctgagtgaatcccagctagaactgagctggagcaacagacacttggac
cactgtctggagcacctggtgcagtaccggagtgactgggaccgcagctggactgaacaa
tcggtggaccaccgaaatagcttctctctgcctagtgtggatgggcagaaattctacacg
ttccgtgtccggagccgctataatccgctctgcggaagcgctcagcgttggagtgaatgg
agccgcccagtccactggggcagcaacacttccaaggagaatccttggttgtttgcattg
gaagctgtgcttatcccccttgtctccatgggattgattattagccttatctgtgtgtac
tgctggctggaacggacgattccccgaattcctaccctcaagaacctagaggatctggtt
accgaataccacggaaatttttcggcctggagtggagtgtccaagggcctggcggagagc
ttgcagccagactacagtgaatggctttgtcacgtcagtgagattcccccaaaaggaggg
gctccaggggaggggcctgggggctccccttgcagccagcatagcccctactgggctccc
ccatgttacaccctgaaacctgaaaccagagccctgataccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162173
Entry
111162173         CDS       T05871                                 

Definition
(RefSeq) interleukin-21 receptor isoform X1
  KO
K05075  interleukin 21 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162173
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162173
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111162173
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111162173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111162173
   04090 CD molecules [BR:elk04090]
    111162173
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111162173
CD molecules [BR:elk04090]
 Proteins
  111162173
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 111162173
NCBI-ProteinID: XP_022382083
UniProt: A0A2Y9LEQ3
LinkDB
Position
Unknown
AA seq 545 aa
MPCGSVASLLLLLLQGAWGCLDLVCYTDYLQTVTCTLETRTLPLGVLTLTWQDPYGDLED
EVTSCSLLWSAHNATHAKYTCHMDVFHFMADDIFSVNVTDQSGSYSQECGSFLLAKSIKP
SPPFNVTVTFSGHYNISWSSSYDSYALKGKLQYELRYRKRGGPWAPQRPRIKLISVDSRS
VSLHPSEFLSDASYELQVRAGPQPGSSFQGTWSEWSDPVTFHTQPGEEIKGGWQPSLLYL
LLVVILPILVFLGLKIHLPWRLWKKVWGHVPNPQKFFQPLYVGHSGDFKKWVGAPFTASS
LELGPRSPEVLSSLAMHNHCPPQSSTKGPQSMQLPEPPHLVGADGVPEPGSWGPACSPIG
SVGGSAYSQERDRPYGVLVSINTVTVADMEGPCAWSCTCGDDGYPALNLDASLEPGSGTE
DPLLDPGTTVLSCGCVSAGGLAGPGGPMGSLLDRLKLPLDEEAGWTPGPLWSGGPPREAS
DSEVGSPPAGLDMDTFDSGFAGSDCGSPVECDFTSPRDEGPPRSYLRQWVVMAPPPEGPG
PQASQ
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgccttgcggctcagtggcctctctgctcctgctcctgctccagggtgcctggggttgc
ctagacctcgtctgctacacggattacttacaaacagtcacctgcaccctggaaaccagg
accctccccctcggtgtgctcaccctcacatggcaagacccatacggagacctggaggat
gaggtcacctcctgcagcctcctctggtccgcccacaacgccacgcatgccaagtacacg
tgccatatggatgtgtttcacttcatggccgacgacattttcagtgtcaatgtcacagac
cagtccggaagttactcccaggagtgcggcagcttcctcctggctaagagcatcaagccg
tccccgcctttcaacgtgaccgtgaccttctcaggacattataacatctcctggagctcc
agctacgattcctatgcgctgaagggcaagctgcagtatgagctgagatacaggaagcgg
ggaggaccctgggccccgcagcgtccaaggatcaagctgatctccgtggactcgagaagc
gtctctctccatccctcggagttcctgagcgatgcgagctatgagctgcaggtgcgcgca
gggccccagcccggctcctccttccaggggacctggagcgagtggagtgacccggtcacc
tttcacacccagccgggggaagagatcaagggaggctggcaaccttccttgctctacctc
ctcctggtcgtcatactccccatcctcgtcttcttaggcctgaagatccacctgccttgg
aggctgtggaagaaggtgtgggggcatgtgcccaacccacagaagttcttccagcccctg
tatgtgggccacagtggagacttcaagaaatgggtgggcgcccccttcactgcctccagc
ctggagctgggaccccggagccccgaggtgctttcgtccctggcgatgcacaaccattgc
ccgccgcagagcagcaccaaggggccgcagtccatgcagctgcccgagcccccccacctg
gtgggagctgacggggtgcctgagccaggctcctggggcccggcctgctcccctatcggc
agtgtgggtggctcggcttacagccaggagagggaccgaccgtatggtgtgctggtgtcc
attaacaccgtgaccgtagcagacatggagggcccgtgtgcctggtcctgcacctgtggg
gatgacggatacccggccctgaacttggacgccagcctggagcccggctcgggcactgag
gacccgctcctggaccctgggaccacagtcctctcctgtggctgtgtctcggcaggtggc
cttgccgggccaggagggcctatgggcagcctcctggacaggctgaagctgcctcttgat
gaggaggcgggctggaccccagggccactgtggagtggcgggccccccagagaggcatct
gacagcgaagtaggctcgcctcccgccggcctggacatggacactttcgacagtggcttc
gcgggctctgactgcggcagccctgtggagtgtgacttcaccagccccagggacgaaggg
cccccccggagctacctccgccagtgggtggtcatggcgcctccgcccgagggacccggg
ccccaggccagccagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162191
Entry
111162191         CDS       T05871                                 

Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162191
   04151 PI3K-Akt signaling pathway
    111162191
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162191
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111162191
   04658 Th1 and Th2 cell differentiation
    111162191
   04659 Th17 cell differentiation
    111162191
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162191
  09163 Immune disease
   05321 Inflammatory bowel disease
    111162191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111162191
   04090 CD molecules [BR:elk04090]
    111162191
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL2 receptor family
   111162191
CD molecules [BR:elk04090]
 Proteins
  111162191
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 111162191
NCBI-ProteinID: XP_022382128
UniProt: A0A2Y9LA06
LinkDB
Position
Unknown
AA seq 806 aa
MGRLCPGLTFPVSCLILVWVAGSGSVKVLQEPSCFSDYVSISVCQWEMDGPTNCSAELRL
SYQLDFIGSENRTCVPENREGAVCMCCMSIDDVVQADIYQLDLWAGKQQLWGGSFQPSKH
VKPRAPGNLTVDPSVSHMWLLMWTNPYPTDNHLYSELTYMVHISNENDPTDFKVYNVTYM
DPTLRVAASTLKSGASYSARVRAWAQNYNSTWSEWSPSTTWVNRYEPWEQHLPLGVSISC
LVILAICLSCYISIIKIKKGWWDQIPNPAHSPLVAIVIQDSQVSLWGKRSRGQEPAKCPH
WKSCLTKLLPCLLEHGMDRDEECSKTARNAPFQAPGKSAWCPVEVSKTIHWPESISVVQC
VELFEAPVENEDDEEVEEDKRSFCPSLQDSGGGFQEGREDIAARLTESLFLDLLGGETGG
FCPQGLEESCFPPPSGTECVQRPWAEFPGTGPQEASLRGREQPLHPESAPWAPLTQRPAS
PAFPEMPPIVTDNPAYRSFGSLLSQSAAPGEGDSDPEQTERPGEVDPSIPSTHQPEPESW
EQILRQSVLQHRAAPAPGPGSGYQDFACAVRQAGVPDADGVAGFGPSGDVGYKAFSSLLP
GTSGGEASPGDGSYKPFQSLPPGGSGTPFPIPLFTFGLDVEPPRGPGDPPLTDSAPEHPR
AEPAGKAGDRCKTLLAPEPATDALRDDLAGSIVYSALTCHLCGHLKQWHGQEERGKAHVV
PSPCCGCCCGDRSSPLGTPLRAPDTLPAGASPEASLSPAPRAPLGVSGEDKSSPSFQLAP
GNAQSSGQAPGKVTVLSTEPTCTSAS
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggggcggctttgccctgggctcacattccctgtgagctgcctgatcctggtgtgggta
gcaggctctgggagtgttaaggtcctgcaggagcccagctgcttctccgactacgtcagc
atctctgtctgtcagtgggagatggacggtcccaccaactgcagtgccgagctccgcctg
tcctatcagctggactttatagggtctgagaaccgcacgtgtgtccccgagaaccgagaa
ggtgcggtatgcatgtgctgcatgtccatagatgacgtggtccaggccgacatctatcag
ctggacctgtgggctgggaagcagcagctgtggggcggctccttccagcccagcaaacat
gtgaagcccagggcccccgggaacctcacggttgaccccagcgtctcccacatgtggctg
ctgatgtggacaaacccataccctaccgacaatcacctgtactccgagctcacctacatg
gtccacatttccaatgaaaacgaccccacggacttcaaagtctataatgtgacctacatg
gaccctaccctccgtgtggcagccagcaccctgaagtctggcgcttcctacagcgcgcga
gtgagggcctgggcccagaactacaacagcacgtggagcgagtggagccccagtaccacg
tgggttaaccgctatgagccctgggagcagcacctgccgcttggtgtcagcatctcctgc
ctggtcatcctggccatctgtctgtcctgctacatcagcatcatcaagattaagaaagga
tggtgggaccagattcccaacccagcccacagtcccctagtggccatagtcatccaggac
tcacaggtgtcactgtgggggaagcggtcccgaggccaggaaccagctaagtgcccacac
tggaagtcctgtcttaccaagctccttccctgtttgctggagcacggcatggacagggat
gaggagtgctccaagactgccagaaatgcacctttccaggctcctggaaaatcagcatgg
tgccccgtggaggtcagcaagacgatccactggccagagagcatcagcgtggtgcagtgt
gtggagctctttgaggccccagtggagaatgaggacgatgaggaggtggaggaagataaa
agaagcttctgcccatcgctccaggacagcgggggcggattccaggagggcagggaggac
atcgcggcccggctgacagaaagcctctttctggaccttcttgggggggagactgggggc
ttttgcccgcagggtttggaggagtcctgctttcctcctccttcaggaactgagtgcgtt
cagaggccctgggctgagttcccggggacagggccccaggaggcatcactccggggccgg
gagcagcctctgcaccccgagtccgctccttgggcccctctgacccagaggccagccagc
ccggctttcccagagatgccccccatcgtcacagacaaccccgcgtaccgcagcttcggc
agcctcctgagccagtccgcagctcccggggagggggactctgacccagagcagactgaa
cgccccggggaggtggaccccagcatcccctccacccaccagcccgagccagagagctgg
gagcagattctgcgccagagtgtcctccagcaccgggcggccccggcccccggccctggc
agtggctaccaggacttcgcatgcgctgtgaggcaggccggtgtccccgatgctgacggg
gtggcgggcttcggcccttctggggacgtgggctacaaggccttctccagcctgctcccg
gggacatctgggggcgaggccagccctggagacgggagctacaaaccttttcagagcctc
cctccgggcggctcggggacccccttccccatccccctgttcacctttggactggatgtg
gagccaccacgcggtcctggggacccgcctctcacagacagtgccccggagcatccgcgt
gcagagccagcagggaaggcaggggacaggtgcaagaccctgctggccccggagccagcc
acagacgccctcagggacgacctggccggcagcatcgtctactcggcccttacctgccac
ctgtgtggccacctgaaacagtggcatggccaggaggagcgtggcaaggcccacgtggtg
cccagcccctgctgtggctgctgctgtggtgacaggtcctcgccgctggggacccccctg
agggccccagacaccttgccagcgggagcttccccagaggccagcctctctccagccccc
cgggcacccctgggcgtctcaggggaggacaagtcctccccgtccttccagctggcccct
ggcaatgcgcagagctcaggccaggcccccggaaaggtgaccgtgctgtccacagagccc
acgtgcacgagcgcttcttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162412
Entry
111162412         CDS       T05871                                 

Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162412
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162412
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111162412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111162412
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL6/12 receptor family
   111162412
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 111162412
NCBI-ProteinID: XP_022382528
UniProt: A0A2Y9LBC6
LinkDB
Position
Unknown
AA seq 749 aa
MGREDATLVSAVLGGALQQATGRPPSPSAAAAGAAGDFPPGREGAGSRRARCGGSWELRD
ASLRGSPLGRESQAGGATALGRAGPGRTRGRGGAPCGGPGPPLFGPRPKLVLLPLLLLLS
HRTRSRDSPGPLQCYGVGPLGDLNCSWEALGDLGAPSTLHLQSQKYHSKRTWTVPVPAGQ
SWVTIPREQLTMSDELLVWGAKAGQPLWPPVFVNLETRMKPDAPRLYPDVDFSEDEPLEA
TVHWAPPVWPPHNVMACQFYYRRCQGTAWTPLEPELKSIPLAPVEIQDLELATGYEVRGH
CRMEKEENLWSEWSPILSFQTLPSAPKDVWISGNLCGTTGRQEPLLLWKDPGHCVQMSYK
VWFQAEGQELIQKTAPCCSSFVPALAEWVGVSAINATSWEPLNNLSLACLGPDLAPRGVV
VSSIAGSTGLLVTWQRGSGELQEHVVDWAQDGDPLEDLSWIRLPPENLSALLPGNFEGGV
PYRITVTAVSPWGMAPAPSVWRFREELAPLAGPVLWRLQDAPPGTPAIAWGEVPRHQLRG
HLTHYTVYVQSGTKPTVCMNVSRSTRNITLPDLPWGPCELWVTASTNAGQGPPGPSLRLH
LPDNSLKWKVLPGVFLLWGLLLTGCGVSLATSRRCLHLRHKVLPRWVWEKIPDPANSNCG
QSHVEEVPQAQPPRDLPILKVEEMEPLPVMEPPQTSIQLGSGYEKHFLPTPEELGLLGPP
PVPKFWPEPSPGQERGAHLTDEDTEAQRG
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggggagggaggatgccacgctcgtctcagcagtgctcggcggcgccttgcagcaagcc
accggccgtcccccctccccttccgcggcggcagccggcgcggcgggggactttccgcct
gggagggaaggggcggggtcccggcgagcaaggtgcggaggcagctgggagctgagggac
gcttcccttcgcggctcgccgttggggcgggagagccaggcgggcggcgcgacagcgctg
ggccgggcagggccgggcaggactcgggggcgcggtggggcgccatgcgggggccccggg
ccccccctcttcgggccgcggccgaagctggtgctgctgcccctgctgttgctgctgagc
caccggactcggtcccgggacagccctgggccactgcagtgctatggagttggacccttg
ggcgatctgaactgctcgtgggaagctcttggggacctgggagcaccctccacgctgcac
ctccagagccagaagtaccattccaaaagaacgtggactgtgccagtgcctgccgggcag
agctgggtgaccattccgagggaacagcttaccatgtctgatgaactgcttgtctggggt
gccaaagcaggccagcctctctggcccccagtcttcgtgaatctggaaacccgaatgaag
ccagatgcccccaggctgtaccctgacgtggacttttcagaggatgagcccctggaggcc
actgtccattgggccccacctgtgtggccaccccataatgtcatggcctgccagttctac
tatcgaagatgccaggggacggcctggaccccgctggagccggaattgaagtccattccc
ctggcacctgttgaaattcaggacctggagctggccactggctatgaggtgcggggccac
tgccgaatggagaaagaagagaatctttggagcgagtggagccccattttgtccttccag
acactgccctctgctccaaaagatgtatggatatctgggaacctctgtggaacaacaggc
agacaggaacccctgcttctgtggaaggacccggggcactgcgtgcagatgagctataaa
gtttggttccaggctgaaggccaggagctgatccagaagacagctccctgctgcagctcc
ttcgtccccgccctggccgagtgggttggggtgtctgccatcaatgccacgagctgggaa
cctcttaacaacctttctttggcctgcctgggtccagatctcgccccccgaggtgtggtg
gtcagcagcattgccggcagcacagggctgctggtgacttggcagcgggggtctggggag
ttgcaggagcacgtggtggactgggctcaagacggggatcccctggaggacctcagctgg
atccggcttccccctgagaacctcagtgctctgttgccagggaattttgaaggaggggtc
ccctaccgaatcacagtgacagcagtctctccttggggcatggcccctgccccctcagtc
tggaggttcagagaggaactggcgcccctagctgggccggtgctttggcgactccaggat
gcccctccagggacccccgccatagcgtggggagaggtcccaagacatcaactccggggc
catctcacgcactacactgtgtatgttcagagcgggaccaagcctactgtctgcatgaat
gtgagcaggagcacccggaacatcaccctgcccgaccttccctggggtccttgtgagctg
tgggtgaccgcatccaccaacgcaggacaggggccaccaggtcccagcctccggcttcac
ctaccagataacagcctgaagtggaaagttctgccgggtgtctttctcctgtggggcttg
ctcctgaccggctgtggtgtgagcctggccacgtctagaaggtgcctccaccttcggcac
aaggtactgccccgctgggtctgggagaagattcctgatccggccaatagcaattgtggc
cagtcccacgtggaggaggtgcctcaggctcagccccccagggacttgcccatcctgaaa
gtggaggagatggagccgctcccggttatggagcccccccagacctccatccagctgggc
tctggctatgagaaacacttcctgcccacccccgaggagctgggccttctgggcccaccc
ccagttcccaaattctggcctgaacccagcccaggccaggagaggggtgcccatttgaca
gacgaagacactgaggctcagagaggctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162487
Entry
111162487         CDS       T05871                                 

Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162487
   04151 PI3K-Akt signaling pathway
    111162487
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162487
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111162487
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111162487
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  Prolactin receptor family
   111162487
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 111162487
NCBI-ProteinID: XP_022382648
UniProt: A0A2Y9LBP6
LinkDB
Position
Unknown
AA seq 509 aa
MDHLRAHLWPSVGSLCFLLAGAAWASPPKSLDPKFESKAALLAAREPEELLCFTERLEDL
VCFWEEAASAGVGSDNYSFFYQLEGEPWKPCSLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAVSSGAPRYRRIIHINEVVLLDPPTGLLARRADEGGHVVLRWLPPPGAPVASLIR
YEVNISSGNIAAGAQKVEILDGRTECVLSNLRGGTRYTFMVRARMAEPSFGGFWSAWSEP
ASLLTVSDLDPLILTLSLILVLILLLLAVLALLSHRRALKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQNEGCLWWSPCTPFAEDPPAPLEVLSERCWGATQAVEPGAEDEGPLLEPV
GSEHTQDTYLVLDKWLLPRNPPTEDLPRPDGGLDMVATDKGSEASSYSSALSLKPGPEGA
LGTSFEYTILDPSSQLLRPRALPPELPPTPPHIKYLYLMVSDSGISTDYSSGGSQGAQGD
SSNGPFSNPYENSLSPALEPSPPSYVACS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggatcaccttcgggcccacctctggcccagtgtcggctctctctgtttcttgctggct
ggggccgcctgggcttccccacccaaatccctggaccccaagtttgaaagtaaagcggcc
ctgctggctgcccgcgagcccgaagagcttctgtgcttcaccgaacggttggaggacttg
gtgtgtttctgggaggaagcggcaagcgccggggtcggctccgacaactacagtttcttc
taccagctcgagggtgagccatggaagccatgcagcctgcaccaggcgcccacggctcgc
ggcgcggtgcgtttttggtgctcgctgcctacggccgacacgtcgagcttcgtgccctta
gagctgcgcgtcacagcggtatcctcgggcgctccacgctatcgccgtatcatccacatc
aacgaagtggtgctcctggatccccccacggggctgctggcgcggcgggccgacgagggc
ggccacgtggtactgcgttggctcccgcctcctggggccccggtggccagcctcatccgc
tacgaagtgaacatctcctccggcaacatcgcagcgggcgcacagaaggtggagatcctg
gatggtcgcactgagtgtgtgctgagcaaccttcggggtggaacgcgttacaccttcatg
gtacgcgcgcggatggccgagccgagcttcggtggcttctggagcgcttggtccgagcct
gcgtcgctgctgacagttagtgacttggaccccctcatcctgacgctctccctcatcctc
gtgctcatcctgctgctgctggccgtgctcgccctgctctcccaccgcagagctttgaag
cagaagatctggcctggcattccaagccctgagagtgagtttgagggcctcttcaccacc
cacaagggtaacttccagctgtggttgtaccagaatgagggctgcctttggtggagcccc
tgcactccctttgcagaggacccacccgctcccctggaagtcctctctgaacgctgctgg
ggggcaacacaggccgtggagccaggggcagaggatgagggacccctgctggagccagtg
ggcagtgaacatacccaggacacctacctggtgctggacaagtggttgctgccccggaac
ccccccactgaggatctgccacggcctgatggcggtttggacatggtagccacggataaa
ggctcagaagcatcctcctactcatctgctttgtccctgaagcctgggccagagggggcc
ttgggtaccagctttgagtataccatcctggatcccagctcccagctcttgcgcccaagg
gcactgccccctgagctgccccccaccccaccccacataaagtatctgtacctcatggtg
tccgactctggcatctcaactgactacagctcagggggctcccagggagcccagggggat
tcatcgaatggccccttctcaaatccttatgagaacagcctctccccagccctggagcct
tcacctcccagctatgtggcctgctcctag

DBGET integrated database retrieval system