KEGG   Enhydra lutris kenyoni (northern sea otter): 111139191
Entry
111139191         CDS       T05871                                 

Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01523  Antifolate resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05340  Primary immunodeficiency
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111139191
   04014 Ras signaling pathway
    111139191
   04064 NF-kappa B signaling pathway
    111139191
   04668 TNF signaling pathway
    111139191
   04151 PI3K-Akt signaling pathway
    111139191
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111139191
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111139191
   04621 NOD-like receptor signaling pathway
    111139191
   04622 RIG-I-like receptor signaling pathway
    111139191
   04623 Cytosolic DNA-sensing pathway
    111139191
   04625 C-type lectin receptor signaling pathway
    111139191
   04660 T cell receptor signaling pathway
    111139191
   04658 Th1 and Th2 cell differentiation
    111139191
   04659 Th17 cell differentiation
    111139191
   04657 IL-17 signaling pathway
    111139191
   04662 B cell receptor signaling pathway
    111139191
   04062 Chemokine signaling pathway
    111139191
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111139191
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111139191
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111139191
   05203 Viral carcinogenesis
    111139191
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111139191
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111139191
   05221 Acute myeloid leukemia
    111139191
   05220 Chronic myeloid leukemia
    111139191
   05215 Prostate cancer
    111139191
   05222 Small cell lung cancer
    111139191
  09163 Immune disease
   05340 Primary immunodeficiency
    111139191
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111139191
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111139191
   05135 Yersinia infection
    111139191
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111139191
   05170 Human immunodeficiency virus 1 infection
    111139191
   05161 Hepatitis B
    111139191
   05160 Hepatitis C
    111139191
   05171 Coronavirus disease - COVID-19
    111139191
   05164 Influenza A
    111139191
   05162 Measles
    111139191
   05168 Herpes simplex virus 1 infection
    111139191
   05163 Human cytomegalovirus infection
    111139191
   05167 Kaposi sarcoma-associated herpesvirus infection
    111139191
   05169 Epstein-Barr virus infection
    111139191
   05165 Human papillomavirus infection
    111139191
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111139191
   05142 Chagas disease
    111139191
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111139191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111139191
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111139191
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 111139191
NCBI-ProteinID: XP_022347091
UniProt: A0A2Y9IFI7
LinkDB
Position
Unknown
AA seq 412 aa
MSRPPWKSPPCEMVQPSGGPTGDQDVLGEESSLGKPTMLHITSEQGTPETFQRCLEENQE
LRDAIRQSNQVLRERCEELQRFQGSQRKEKEFLVQKFQEARKLVERLSLEKRELRRQTEQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAANKERQALEGRARAASEQ
ARQLESERAALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHVKSSTGMQLEDLKQQLQQAEEALAAKQEVIDKLKEEAEQHKAVMETVPVLKAQADI
YKADFQAERQAREKLAERKELLQEQLEQLQREYGRLKASCQESARIEDLRKRHVEVSQAP
LPPTPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYRAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtccgccgtgtgagatggtgcagcccagtggcggcccg
acaggggaccaggacgtgctgggtgaagaatcttctctggggaagccgaccatgctccac
atcacttctgagcagggcactcccgagaccttccagcgctgcctggaggagaatcaagag
ctccgagacgccatccgccagagcaaccaggtgctgcgcgagcgctgtgaggagctgcag
cgcttccagggcagccagaggaaggagaaggagttcctcgtgcagaagttccaggaagcc
cggaagctggtggagagactgagcctggagaagcgcgagctgcggaggcagacggagcag
gccctgcaggaggtggagcacctgaagcgctgccagcagcagatggctgaggacaaggct
tccgtgaaagcccaggtgacatccttgctgggggagctccaggagagccagagtcgtttg
gaggccgccaacaaggagcggcaggctttggagggcagggctcgggcggccagcgagcag
gcgcggcagctggagagcgagcgggcagcgctgcagcagcagcacagcgtgcaggtggac
cagctgcggatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggcagcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag
tacgacagccacgtcaagagcagcacgggaatgcagctggaggacctcaagcagcagctc
cagcaggcagaggaggccctggcggccaagcaggaagtgattgacaagctgaaggaggag
gccgagcagcacaaggccgtgatggagactgtcccggtgctaaaggctcaggcggacatc
tacaaggccgacttccaggctgagaggcaggcgcgggagaagctggcggagaggaaggag
ctcctgcaggagcagctggagcagctgcagagggagtacggcaggctgaaggccagctgc
caggagtcggccaggattgaagacctgaggaagcgacacgtggaggtctcccaggccccc
ttgccccccaccccagctcacccctccttccacctggccttgcccagccagaggagaagc
ccccctgaggagccgcctgacttctgttgccccaagtgccagtaccgggctccggatatg
gacacgctgcagatccacgtcatggagtgcattgagtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111144397
Entry
111144397         CDS       T05871                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01523  Antifolate resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144397
   04014 Ras signaling pathway
    111144397
   04064 NF-kappa B signaling pathway
    111144397
   04668 TNF signaling pathway
    111144397
   04068 FoxO signaling pathway
    111144397
   04151 PI3K-Akt signaling pathway
    111144397
   04150 mTOR signaling pathway
    111144397
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111144397
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111144397
   04621 NOD-like receptor signaling pathway
    111144397
   04622 RIG-I-like receptor signaling pathway
    111144397
   04623 Cytosolic DNA-sensing pathway
    111144397
   04625 C-type lectin receptor signaling pathway
    111144397
   04660 T cell receptor signaling pathway
    111144397
   04658 Th1 and Th2 cell differentiation
    111144397
   04659 Th17 cell differentiation
    111144397
   04657 IL-17 signaling pathway
    111144397
   04662 B cell receptor signaling pathway
    111144397
   04062 Chemokine signaling pathway
    111144397
  09152 Endocrine system
   04910 Insulin signaling pathway
    111144397
   04920 Adipocytokine signaling pathway
    111144397
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111144397
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111144397
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144397
   05206 MicroRNAs in cancer
    111144397
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111144397
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111144397
   05221 Acute myeloid leukemia
    111144397
   05220 Chronic myeloid leukemia
    111144397
   05215 Prostate cancer
    111144397
   05222 Small cell lung cancer
    111144397
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144397
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144397
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111144397
   04932 Non-alcoholic fatty liver disease
    111144397
   04931 Insulin resistance
    111144397
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111144397
   05135 Yersinia infection
    111144397
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111144397
   05170 Human immunodeficiency virus 1 infection
    111144397
   05161 Hepatitis B
    111144397
   05160 Hepatitis C
    111144397
   05171 Coronavirus disease - COVID-19
    111144397
   05164 Influenza A
    111144397
   05162 Measles
    111144397
   05168 Herpes simplex virus 1 infection
    111144397
   05163 Human cytomegalovirus infection
    111144397
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144397
   05169 Epstein-Barr virus infection
    111144397
   05165 Human papillomavirus infection
    111144397
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111144397
   05142 Chagas disease
    111144397
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111144397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111144397
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111144397
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111144397
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH YrbL-PhoP_reg Med20 ubiquitin Glyco_hydro_65m
Other DBs
NCBI-GeneID: 111144397
NCBI-ProteinID: XP_022354374
UniProt: A0A2Y9J3T6
LinkDB
Position
Unknown
AA seq 756 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
PILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSILAHRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGIIHTYPVTEDESLQSLQARIQQDTGIPEKDQELLQEAGLA
LIPDKPAAQCISDGKLNEGRTLDMDLVFLFDNSKIAYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQIWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVRLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHSGQLLSQPSAAPNSIPEAIKKSGELVTEAHTLCSQLE
HAMQDTIKEQDQSLRSLDWSWLQTEEEEQNSLEQAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttctctgccaacccagacgtgtggggcctgggagatgaaagaacga
ctcgggacagggggatttggaaacgtcatccggtggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccggcaggagctcagcccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgaaccaccccaatgtggtggctgcccgggacgtcccc
gaggggatgcagagcttggctcccaatgacttgcccctcctggccatggagtactgccag
ggaggagatctccgcaagtacctgaaccagttcgagaactgctgtggcctgcgggaagga
cccatccttaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctttgtact
tcctttgtgggcaccctgcagtacttggccccagagctcctggagcagcagaagtacacg
gtgaccgtggactactggagcttcggtaccttggccttcgagtgcatcaccggcttccgc
ccttttctccctaactggcagcccgtgcagtggcactccaaagtccggcagaagagtgag
atggacatcgttgtcagtgaggacctgaacggagccgtgaagttttcaagctccttaccc
taccccaataatctcaacagcatcctggcacatcgactagagaagtggctgcagctgatg
ctgatgtggcacccacgacagaggggcactgatcctgtgtacgggcccaacggctgcttc
aaggccctggatgacatcttaaacctgaagctggttcatatcttgaacatggtcacaggc
atcattcacacctatccagtgacagaggacgagagtctgcagagcttgcaggccagaatc
cagcaggacacaggaatccccgagaaggaccaggagctgctgcaggaggctgggctggcg
ctgatccctgacaagcctgccgctcagtgtatttcagacggcaagctgaatgagggccgc
acgctggacatggatctcgtctttctctttgacaacagtaaaatcgcctatgagactcag
atctccccccggccccaacctgaaagcgtcagctgtatccttcaagagcccaagaggaac
ctgtctttcttccagctgaggaaggtgtggggccagatctggcacagcatccaaaccctg
aaggaggactgtaaccgactgcagcagggacagcgagctgccatgatgaatctccttcgg
aataacagctgcctctccaagatgaagaattctatggcttccatgtctcagcagctcaaa
gccaagttggacttctttaaaaccagcatccagattgacctggagaagtacagtgagcaa
acggagtttgggatcacgtcagataagctgctgttggcctggagggaaatggaacaggct
gtggagctctgtgggcgggagaatgaggtgaggctcctggtggaacggatgatggcgctc
cagaccgacatcgtggacctgcagaggagccccatggggcggaagcagggcggcacgctg
gacgacctagaagagcaggcaagggagctttacaggaggcttcgggagaaacccagagac
cagcgaacggatggcgacagtcaggagatggtccggctgctcctccaggccatccaaggc
tttgagaagaaagtgagagtgatttatacgcagctcagtaaaactgtggtatgcaagcag
aaggctctggaattgttgcccaaggtggaagaggtggtgagtttaatgaatgaagatgag
aagactgttgtccggcttcaggagaagcggcagaaggagctctggaatcttctgaagatc
gcttgtagcaaagtccgtggtcctgtcagtggaagcccagacagcatgaatgcttctcgc
ctcagtcactcgggtcagctgctgtctcagccttctgctgcccccaacagcatacccgag
gccatcaagaaaagtggagagctggtgactgaagcgcacaccctgtgttcgcagctagaa
catgcaatgcaagacaccatcaaagaacaggaccagagtttgaggtctctagactggagc
tggctacagacagaggaagaagaacagaacagcttggaacaggcctcttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111144921
Entry
111144921         CDS       T05871                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01523  Antifolate resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk05010  Alzheimer disease
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144921
   04014 Ras signaling pathway
    111144921
   04064 NF-kappa B signaling pathway
    111144921
   04668 TNF signaling pathway
    111144921
   04068 FoxO signaling pathway
    111144921
   04151 PI3K-Akt signaling pathway
    111144921
   04150 mTOR signaling pathway
    111144921
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111144921
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111144921
   04621 NOD-like receptor signaling pathway
    111144921
   04622 RIG-I-like receptor signaling pathway
    111144921
   04623 Cytosolic DNA-sensing pathway
    111144921
   04625 C-type lectin receptor signaling pathway
    111144921
   04660 T cell receptor signaling pathway
    111144921
   04658 Th1 and Th2 cell differentiation
    111144921
   04659 Th17 cell differentiation
    111144921
   04657 IL-17 signaling pathway
    111144921
   04662 B cell receptor signaling pathway
    111144921
   04062 Chemokine signaling pathway
    111144921
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111144921
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111144921
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144921
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111144921
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111144921
   05221 Acute myeloid leukemia
    111144921
   05220 Chronic myeloid leukemia
    111144921
   05215 Prostate cancer
    111144921
   05222 Small cell lung cancer
    111144921
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144921
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144921
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111144921
   05135 Yersinia infection
    111144921
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111144921
   05170 Human immunodeficiency virus 1 infection
    111144921
   05161 Hepatitis B
    111144921
   05160 Hepatitis C
    111144921
   05171 Coronavirus disease - COVID-19
    111144921
   05164 Influenza A
    111144921
   05162 Measles
    111144921
   05168 Herpes simplex virus 1 infection
    111144921
   05163 Human cytomegalovirus infection
    111144921
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144921
   05169 Epstein-Barr virus infection
    111144921
   05165 Human papillomavirus infection
    111144921
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111144921
   05142 Chagas disease
    111144921
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    111144921
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111144921
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111144921
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111144921
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 111144921
NCBI-ProteinID: XP_022355237
UniProt: A0A2Y9J319
LinkDB
Position
Unknown
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDVKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYSATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPHQRGGPVDLTLKQPRC
FVLMDHILSLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDQYYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVVSSLEGAVTPQASAWLPPASTEREHPLSCVVTPQDGETIAQMIEENLNCLGHL
STIIHEANEEQGSRMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggctttgggaacgtctgcctgtatcagcatcgggaacttgatgtcaaa
atagcaattaagtcatgtcgcctagagctaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgatgtacct
gaggaattgaattttttaattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccggaagttactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcaatatctggccccagaactctttgagaataagccttactcagct
actgttgattattggagctttgggaccatggtctttgaatgtattgctggatacaggcct
tttttgcatcatctacagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagtcatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggcttcagttgatgctg
aattgggatcctcatcaaagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattctgagtttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttttgttaccacctgatgaaagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagacgggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagtcagaggctgtgat
agctatatggtgtatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacgggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggctgaagcagtacactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttaggtacaatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagctaaattg
gagtttttccacaaaagcattcagcttgacttggaaagatacagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaagctatccat
tatgctgaggtgggtgtcattggttacctggaggatcagatcatgtctctacacactgaa
atcatggagctgcaaaagagcccttatggaagacgtcagggagacttaatggaatctctg
gaacaacgtgccattgatctgtataagcagttaaagcacagaccttcagatcaatactac
agcgacagcacggaaatggtgaagatcattgtgcatactgttcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttattgggctgtaaacagaagattattgat
ctcctgcccaaggtggaaatggcccttagtaacatcaaagaagctgacaatactgtcatg
ttcatgcagggaaagagacagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtagtatctagtctagaaggtgcagtaacccctcaggcatca
gcatggcttcccccagcttcaacagaacgtgaacatcctctgtcatgtgtggtaactcct
caagatggggagactatagcacaaatgatagaagaaaatttgaactgtcttggccattta
agcactattattcatgaagcaaatgaggaacagggcagtagaatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system