KEGG   Enhydra lutris kenyoni (northern sea otter): 111139337
Entry
111139337         CDS       T05871                                 

Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111139337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:elk04990]
    111139337
Domain-containing proteins not elsewhere classified [BR:elk04990]
 LIM domain-containing proteins
  FHL family proteins
   111139337
SSDB
Motif
Pfam: LIM Ureidogly_lyase c-SKI_SMAD_bind
Other DBs
NCBI-GeneID: 111139337
NCBI-ProteinID: XP_022347308
UniProt: A0A2Y9IF89
LinkDB
Position
Unknown
AA seq 367 aa
MCFVWRPASEMRPAPRESSPALAEAGSETQGVVSLAHSVLFGCLWQRDPNNLDMCLYKKT
GNGTQSGSPGPFSWWKSHGPASYKVGTMTEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFD
KFCANTCVECRKPIGADSKEVHYKNRYWHDTCFRCAKCLHPLANETFVAKDNKIFCNKCT
TREDAPKCKGCFKPIVAGDQNVEYKKTIWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTC
HETKFAKHCVKCNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCY
KNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHEEQVYC
PDCAKKL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtgctttgtctggaggccagcttctgaaatgcgcccagctccgagggagagttcacca
gccttggccgaggcgggctccgagacgcagggtgtggtttccttagctcactctgtgcta
tttggttgcctgtggcaacgggatccaaacaacttggacatgtgtttgtataaaaaaact
gggaatgggacccagagtgggagtccggggccattcagctggtggaagagccacggtcca
gccagctacaaggtgggcaccatgactgagaagttcgactgccactactgcagggacaac
ctgcagggcaagaaatacgtgcagaaggatggccaccactgttgcctgaagtgcttcgac
aagttctgcgccaacacctgtgtggagtgccggaagcccatcggcgctgactccaaggag
gttcactataagaaccgctactggcatgacacctgcttccgctgtgccaagtgcctgcac
cccttggccaatgagacctttgtggccaaggacaacaagatcttttgcaacaagtgcacc
acgcgggaggatgcccccaagtgcaaggggtgcttcaagccgatcgtggcaggagatcag
aacgtggagtacaagaagaccatctggcacaaagactgcttcacctgcagcaactgcaaa
caagtcatcgggactggaagcttcttccccaaaggggaggacttctactgcgtgacttgc
catgagaccaaatttgccaagcattgcgtcaagtgcaacaaggccatcacatctggagga
atcacttaccaggatcagccctggcatgccgagtgctttgtgtgtgttacctgctctaag
aagctggctgggcagcgtttcaccgctgtggaggaccagtattactgcgtggattgctac
aagaactttgtggccaagaagtgtgctggatgcaagaaccccatcactgggtttggtaaa
ggctccagtgtggtggcctatgaaggacaatcctggcacgactactgcttccactgcaaa
aagtgctccgtgaacctggccaacaagcgctttgttttccacgaggagcaagtgtattgc
cccgactgtgccaaaaagctgtaa

DBGET integrated database retrieval system