KEGG   Enhydra lutris kenyoni (northern sea otter): 111139338
Entry
111139338         CDS       T05871                                 

Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04810  Regulation of actin cytoskeleton
elk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111139338
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111139338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111139338
Membrane trafficking [BR:elk04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111139338
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF RhoGEF67_u1 CH SH3_2 SH3_9 SH3_1 PH CAMSAP_CH ZapB Nsp1_C
Other DBs
NCBI-GeneID: 111139338
NCBI-ProteinID: XP_022347313
UniProt: A0A2Y9IF91
LinkDB
Position
Unknown
AA seq 775 aa
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSLEKYCSEP
QTEADCLNNIGDFLKGCATLQVEVFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVVSAPPGLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKN
YYTVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEICLFQQTLC
QALEECSKFPENQHRVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLEQFMESQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGESIKTLGNVLFMSQVMVQYGTCEEKEERYLLLFSSVLIM
LSASPRMSGFIYQGKIPVAGMVVTRLDEIEGNDNTFEITGNIERIVIHCNSSQDFQEWLE
QLCRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQMIKPWSLSCLRPAPPLR
PSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILR
VIEAYCASANFQQGHGSSARKDSLPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYAL
KDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSILP
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgaacccagaagagcgaatcgtgacatggcttatatccttgggagttttagattccccc
aaaaagaccatctgtgatccggaggagttcttgaagtcctctctgaagaatggggtagtg
ctgtgcaaattgatcaacagacttaggcctggctctctagaaaagtactgctcggagccc
caaaccgaagctgactgcctcaacaacattggtgacttcctgaaaggatgtgcgaccctt
caggtggaggtattcgatcctgatgacctttattcaggggtcaacttctccaaggttctg
agcacacttttagctgtcaacaaggcaacagaagatcagctctcagaaagaccatgtgga
cgttcctcttctcttagtgctgctaatagttctcagacgaacccgcagggagcggtggtt
agcgcacctccaggcctgcaaaggcagtccaaggcagtggagatgacggaaaatggaagc
catcagttgatagtaaaggcaagattcaactttaagcagacaaatgaagatgagctgtcg
gtttgtaaaggggacatcatttatgtcaccagagttgaagaaggaggctggtgggaaggc
acattaaatggcagaacaggctggttccctagtaattatgtccgagaaattaaatccagt
gagagacctctgtcccccaaggctgtcaaaggatttgaaactactccacttaccaagaac
tattatactgtggtgttacagaacattttggacactgaaaaggattatgctaaagaactt
cagtctctgcttgtcacttacttaagacccctgcagtccaataacaatctgagtactgtg
gagtttacatctttattggggaacttcgaggaaatatgcttgtttcagcagacactctgt
caagccttggaagaatgttccaagtttccagaaaaccaacacagagtcggaggttgtcta
ttgaacctcatgcctcattttaaatctatgtacctggcttactgtgcaaatcatccgtca
gctgtcaatgtgcttacacagcacagtgatgatctggaacagttcatggaaagtcaaggt
gcatccagcccagggatcctcattttaacaaccagcctcagcaaaccgttcatgcgactg
gaaaagtacgttactctcttgcaggagttggaacggcacatggaggacacgcatccggat
caccaggatattctgaaagcaatcatagccttcaaaacgctcatggggcagtgccaagat
ctaagaaagagaaaacagctggagttgcagatactttctgagcctatccaggcctgggaa
ggagagagtattaaaaccttgggaaatgtgctgtttatgtcacaagtaatggtgcagtat
ggaacatgcgaggaaaaagaggagcggtaccttctgttattctccagtgtcctgataatg
ttatcggcaagtcctcggatgagtggctttatctaccagggaaaaataccagtagcggga
atggtggtgactagattagatgaaatcgaagggaatgacaacacatttgaaatcacaggt
aacatagagagaatcgtcatccactgcaacagcagtcaggacttccaggagtggctggag
cagctgtgcagactcatccggggacccgcctcctgcagctcgttatctaaaacgtcatcg
tcatcttgcagcgcccattcctcttttagctctactggacagccccgaggacccctggaa
cctcctcagatgataaagccgtggagtttaagttgtctgcgacctgcacctccacttaga
ccgtcagcagcactaggttataaagagaggatgtcttatatcttaaaggagtctagtaaa
agccccaaaacgatgaagaagtttcttcacaaaagaaagaccgaaagaaagccgtcggag
gaggaatacgtgattcggaaaagtaccgccgctctggaagaagatgcacagatccttagg
gtgattgaagcctactgcgccagcgcgaactttcagcaaggccacggctcaagtgctcgc
aaagattcactcccacaagtcttactccccgaggaggagaaactcatcattgaagaaacc
aggagcaatggccagactatcattgaagaaaagagtctggttgacactgtgtatgccttg
aaggatgaggtcaaagaactgaaacaggaaaataaaagaatgaagcagtgcctggaagaa
gaattgaaatcaagaagggacctagaaaagctggtgcggaggctgttgaagcagactgat
gagtgtattcgggctgagtccagtagcaagacctccattcttccgtaa

DBGET integrated database retrieval system