KEGG   Enhydra lutris kenyoni (northern sea otter): 111139584
Entry
111139584         CDS       T05871                                 

Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111139584
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111139584
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111139584
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    111139584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111139584
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111139584
SSDB
Motif
Pfam: IL11 SlyX
Other DBs
NCBI-GeneID: 111139584
NCBI-ProteinID: XP_022347621
UniProt: A0A2Y9IH62
LinkDB
Position
Unknown
AA seq 199 aa
MNSVCCLVLVALSLWPDRAAAPGPPPGPPRASPDPRAELDSAVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLR
TLEPELGALQARLDRLLRQLQLLMSRLALPQAPPDPPAPPLAPPASAWGGIRAAHAILGG
LRLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaacagtgtttgctgcctggtcctggtcgccctgagcctgtggccagatagagctgct
gcccccgggccgcctcctggccccccacgggcctccccagaccctcgggctgagctggac
agcgccgtcctcctgacccgttccctcctggcggacactaggcagcttgccgcccagctg
agggacaaatttccagccgacggagaccacaacctggactctcttcccaccttggccatg
agtgcaggggcgctgggagccctgcagctcccaggtgtgctgacacggctgcgggcggac
ctgttctcctacctgcgccacgtgcagtggctgcgccgagctgggggcccttccttgcgg
accctggagccggagctcggtgccctgcaggcccggctggaccgcctgctgcgccagctg
cagctcctgatgtcccgcctggccttaccccaggcgcccccagacccaccagctccccca
ctagcgcccccggcctccgcctggggaggcatcagggcagcccatgctattcttgggggg
ctgcgcctgacccttgactgggctgtgcggggcttgctgctgctgaagactcggctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140329
Entry
111140329         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140329
   04151 PI3K-Akt signaling pathway
    111140329
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140329
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140329
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140329
   04621 NOD-like receptor signaling pathway
    111140329
   04622 RIG-I-like receptor signaling pathway
    111140329
   04623 Cytosolic DNA-sensing pathway
    111140329
   04650 Natural killer cell mediated cytotoxicity
    111140329
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140329
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140329
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140329
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140329
   05161 Hepatitis B
    111140329
   05160 Hepatitis C
    111140329
   05171 Coronavirus disease - COVID-19
    111140329
   05164 Influenza A
    111140329
   05162 Measles
    111140329
   05168 Herpes simplex virus 1 infection
    111140329
   05163 Human cytomegalovirus infection
    111140329
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140329
   05169 Epstein-Barr virus infection
    111140329
   05165 Human papillomavirus infection
    111140329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140329
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140329
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111140329
NCBI-ProteinID: XP_022348320
UniProt: A0A2Y9IQN0
LinkDB
Position
Unknown
AA seq 187 aa
MALPCSFLVALVMLSCPSLGSLGCDLPQDHGLLHWRALMLLQQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQTLSVIHVTNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACALQEAGVGEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAETMKPLYASTALH
KRLRSRK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtgatgctcagctgcccctccctcggt
tctctgggatgtgacctgcctcaggaccacggcctgctgcactggagggccttgatgctc
ctgcaacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgacggcaagcagctacagaaggctcaaaccctctctgtcatc
catgtgactaaccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggtcacctggaa
gcctgtgccctgcaggaggcgggggtgggagagatgcccctggtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcgagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagaccatgaaacccttgtatgcatcaacagccttgcat
aagagattgcggagcaggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140335
Entry
111140335         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140335
   04151 PI3K-Akt signaling pathway
    111140335
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140335
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140335
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140335
   04621 NOD-like receptor signaling pathway
    111140335
   04622 RIG-I-like receptor signaling pathway
    111140335
   04623 Cytosolic DNA-sensing pathway
    111140335
   04650 Natural killer cell mediated cytotoxicity
    111140335
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140335
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140335
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140335
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140335
   05161 Hepatitis B
    111140335
   05160 Hepatitis C
    111140335
   05171 Coronavirus disease - COVID-19
    111140335
   05164 Influenza A
    111140335
   05162 Measles
    111140335
   05168 Herpes simplex virus 1 infection
    111140335
   05163 Human cytomegalovirus infection
    111140335
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140335
   05169 Epstein-Barr virus infection
    111140335
   05165 Human papillomavirus infection
    111140335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140335
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140335
SSDB
Motif
Pfam: Interferon PORR
Other DBs
NCBI-GeneID: 111140335
NCBI-ProteinID: XP_022348325
UniProt: A0A2Y9L3M9
LinkDB
Position
Unknown
AA seq 179 aa
MPTPARPTASVGSPMALPCSFLVALVVLSCHFLGSLGCDLPQDHGLLHWRALMLLQRMKR
LSASSCDKYTNDFGFPQEVFDSKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLE
ELCSGLSEQLGHLEACPLQEAGVEEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMV
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccaccccagccaggccaacagcatctgtaggatcccctatggccctgccctgctcc
ttcttggtggccctggtggtgctcagctgccacttcctcggctctctgggatgtgacctg
cctcaggaccatggcctgctgcattggagggccttgatgctcctgcaacgaatgaagaga
ctgtctgctagctcctgtgacaagtacacaaacgactttggcttcccccaggaggtgttt
gacagcaagcagctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaag
accttccacctcttctgcacagaggcctcacctgctccttggaacacgactctcctggag
gaattgtgctcgggactttctgagcagctgggccacctggaagcctgtcccctgcaggaa
gctggggtagaagagatgcccctggtgaatggggactccatcctgaggaactacttccag
agaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140336
Entry
111140336         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140336
   04151 PI3K-Akt signaling pathway
    111140336
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140336
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140336
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140336
   04621 NOD-like receptor signaling pathway
    111140336
   04622 RIG-I-like receptor signaling pathway
    111140336
   04623 Cytosolic DNA-sensing pathway
    111140336
   04650 Natural killer cell mediated cytotoxicity
    111140336
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140336
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140336
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140336
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140336
   05161 Hepatitis B
    111140336
   05160 Hepatitis C
    111140336
   05171 Coronavirus disease - COVID-19
    111140336
   05164 Influenza A
    111140336
   05162 Measles
    111140336
   05168 Herpes simplex virus 1 infection
    111140336
   05163 Human cytomegalovirus infection
    111140336
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140336
   05169 Epstein-Barr virus infection
    111140336
   05165 Human papillomavirus infection
    111140336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140336
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140336
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111140336
NCBI-ProteinID: XP_022348326
UniProt: A0A2Y9IJA3
LinkDB
Position
Unknown
AA seq 228 aa
MHKRRCSEKLEPRVPDMPTSARPTTSVGSPMALPCSFLVLLVVLTCHSLGSLGCDLPQDH
GLVPWRALMLLQRMKRLSASSCDNYTNDFGFPQEAFDGKQLQKAQALSVIHVMNQKTFHL
FCTEASPAPLNTTLLEELCSGLSEQLGRLEACPLQEAGVGETPFVNGDSILRNYFQRISL
YLQEKQYSPCAWEMVRAEIMKPLYASTALHKRLRSRKGHPFQRGNGSL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagctagagccacgggtcccagacatgcccacctca
gcgaggccaacaacatctgtaggttcccccatggccctgccctgctccttcttggtgctc
ctggtggtgctcacttgccactccctcggctctctgggatgtgacctgcctcaggaccac
ggcctggtgccctggagggccttgatgctcctgcaacgaatgaagagactgtctgctagc
tcctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgatggcaagcag
ctgcagaaggctcaagccctctctgtcatccatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctcctttgaacacgacactcctggaggaattgtgctcg
ggactttctgagcagctgggccgcctggaagcctgtcccctgcaggaggcgggggtggga
gagacgcccttcgtgaatggggactccatcttgaggaactacttccagagaatctccctc
tatctgcaagagaagcaatacagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacagccttgcataagagattgcggagcaggaagggacacccc
tttcaacgtggaaatggttctctctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140482
Entry
111140482         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140482
   04151 PI3K-Akt signaling pathway
    111140482
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140482
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140482
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140482
   04621 NOD-like receptor signaling pathway
    111140482
   04622 RIG-I-like receptor signaling pathway
    111140482
   04623 Cytosolic DNA-sensing pathway
    111140482
   04650 Natural killer cell mediated cytotoxicity
    111140482
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140482
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140482
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140482
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140482
   05161 Hepatitis B
    111140482
   05160 Hepatitis C
    111140482
   05171 Coronavirus disease - COVID-19
    111140482
   05164 Influenza A
    111140482
   05162 Measles
    111140482
   05168 Herpes simplex virus 1 infection
    111140482
   05163 Human cytomegalovirus infection
    111140482
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140482
   05169 Epstein-Barr virus infection
    111140482
   05165 Human papillomavirus infection
    111140482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140482
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140482
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111140482
NCBI-ProteinID: XP_022348436
UniProt: A0A2Y9IJL4
LinkDB
Position
Unknown
AA seq 175 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQEHGLLNWRALMLLQQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQALSVIHVTNQKTFHLFCTGTSPAPWNTTLLEELCSGLSEQLGLLE
ACPLQEAGVGETPFVNGDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKPLYA
NT seq 525 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaacatggcctgctgaactggagggccttgatgctc
ctgcaacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgatggcaagcagctgcagaaggctcaagccctctctgtcatc
catgtgactaaccagaagaccttccacctcttctgcacagggacctcacctgctccttgg
aacactaccctcctggaggaattgtgctcgggactttctgagcagctgggcctcctggaa
gcctgtcccctgcaggaggcgggggtgggagagacgcccttcgtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgca

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140592
Entry
111140592         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140592
   04151 PI3K-Akt signaling pathway
    111140592
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140592
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140592
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140592
   04621 NOD-like receptor signaling pathway
    111140592
   04622 RIG-I-like receptor signaling pathway
    111140592
   04623 Cytosolic DNA-sensing pathway
    111140592
   04650 Natural killer cell mediated cytotoxicity
    111140592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140592
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140592
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140592
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140592
   05161 Hepatitis B
    111140592
   05160 Hepatitis C
    111140592
   05171 Coronavirus disease - COVID-19
    111140592
   05164 Influenza A
    111140592
   05162 Measles
    111140592
   05168 Herpes simplex virus 1 infection
    111140592
   05163 Human cytomegalovirus infection
    111140592
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140592
   05169 Epstein-Barr virus infection
    111140592
   05165 Human papillomavirus infection
    111140592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140592
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140592
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111140592
NCBI-ProteinID: XP_022348506
UniProt: A0A2Y9IJS4
LinkDB
Position
Unknown
AA seq 182 aa
MALPSFFLVALVVLSCHSLGSLGCELPQDYGLMHWRALMLLRHMRTMSASSCDKYTNDFG
FPQQVFDGKGLQKAQALPVVHVMNQKTHHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACPLQETPLLNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALHKRLRS
RK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggccctgcccagcttcttcttggtggccctggtggtgctcagctgtcactcccttggt
tctctgggatgtgaactgcctcaggactacggcctgatgcactggagggccttgatgctc
ctgcgacacatgaggacaatgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccagcaggtgtttgacggcaaggggctgcagaaggctcaagccctccctgtcgtc
catgtgatgaaccagaagacccaccacctcttctgcacagaggcctcacctgctccctgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggagacacccctgctgaatggggactccatcctgaggaactacttc
cagagaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtc
cgagcagagatcatgaaacccttgtatgcatcaacagccttgcataagagattgcggagc
aggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140799
Entry
111140799         CDS       T05871                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04664  Fc epsilon RI signaling pathway
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05221  Acute myeloid leukemia
elk05310  Asthma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140799
   04151 PI3K-Akt signaling pathway
    111140799
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140799
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111140799
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111140799
   04664 Fc epsilon RI signaling pathway
    111140799
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140799
   05202 Transcriptional misregulation in cancer
    111140799
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111140799
  09163 Immune disease
   05310 Asthma
    111140799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140799
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111140799
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111140799
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111140799
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 111140799
NCBI-ProteinID: XP_022348685
UniProt: A0A2Y9IRS3
LinkDB
Position
Unknown
AA seq 142 aa
MNSLPVLHLLLLLLGLQAPQAQGRSLLTYPPQQNFKMISEITDILNSSPSPAEETLDPNE
TNTLLNTTLLRPNLDAFLNATKNFYSNESLIWKNLKEFLPLLPTPTPRGEPISIENNWSD
FQKKLKKYLEALDNFLNFRNNH
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaacagcctccctgtcctgcaccttctcctgctcctgcttggactgcaagccccgcag
gcccaggggcggtccttgctgacatacccgcctcagcaaaacttcaagatgatcagtgaa
attacagacatcttaaacagttcaccctcgcctgcagaagaaaccttggacccaaatgag
acaaacaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacagcaacgaatcacttatctggaaaaatcttaaggaattcctgcca
ctcctgccgactcccacacccaggggagaaccaatctctattgagaataactggagtgat
ttccaaaagaagctgaaaaaatatctggaagcccttgataactttctgaatttcaggaac
aaccactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141057
Entry
111141057         CDS       T05871                                 

Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk05310  Asthma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141057
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141057
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111141057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141057
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141057
SSDB
Motif
Pfam: AvrRpt-cleavage
Other DBs
NCBI-GeneID: 111141057
NCBI-ProteinID: XP_022349094
UniProt: A0A2Y9IP17
LinkDB
Position
Unknown
AA seq 143 aa
MLLPVVVLASALLLCSVTSQSCPTFMGIRDVTHLIDKLQEHPASKCNCSHANVTDCLCLT
IPSDNCTTTCFQEGLSQMTNSTVGTRYTLIFNRVKRTVQDLKKNKCQFFSCEQPCNQTTT
GNMLTFLRSLQETLQKQRAIGRV
NT seq 432 nt   +upstreamnt  +downstreamnt
atgctcctgcccgtggtggtccttgcctctgccctgctcctctgctccgtgaccagccag
agttgtccgaccttcatggggatcagggatgtcacacacctcattgacaaactgcaggaa
catccagcttcaaaatgcaactgcagccatgccaatgtgactgattgtttgtgtctgacc
attccttctgacaactgcaccacaacgtgcttccaggaaggtctgtcccagatgaccaac
tccactgtgggaacaagatacaccctgattttcaatcgagtaaaaagaacagtccaagac
ctaaagaaaaacaagtgccagtttttttcctgtgaacaaccatgtaaccaaaccacaaca
ggcaacatgctgacgtttctgcggagtctccaggaaactcttcagaaacaaagggcgata
ggcagagtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141099
Entry
111141099         CDS       T05871                                 

Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04672  Intestinal immune network for IgA production
elk05140  Leishmaniasis
elk05200  Pathways in cancer
elk05310  Asthma
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141099
   04151 PI3K-Akt signaling pathway
    111141099
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141099
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141099
   04660 T cell receptor signaling pathway
    111141099
   04658 Th1 and Th2 cell differentiation
    111141099
   04659 Th17 cell differentiation
    111141099
   04657 IL-17 signaling pathway
    111141099
   04664 Fc epsilon RI signaling pathway
    111141099
   04672 Intestinal immune network for IgA production
    111141099
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141099
  09163 Immune disease
   05310 Asthma
    111141099
   05320 Autoimmune thyroid disease
    111141099
   05321 Inflammatory bowel disease
    111141099
   05330 Allograft rejection
    111141099
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111141099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141099
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141099
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141099
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111141099
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 111141099
NCBI-ProteinID: XP_022349139
UniProt: A0A2Y9IP66
LinkDB
Position
Unknown
AA seq 132 aa
MGLTSQLIPTLVCLLALTGTFIHGHNFSIAIKEIIKTLNILTARNDSCMKLTITEVFTAP
KNTSEKEIFCRAATVLQQLSTHNCSNRLLRGLHRNLRNMANTTCSVNEVKKSTLKDFLER
LKVIMQQKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccggcact
ttcatccacggacataacttcagtattgccattaaggagatcatcaaaacattgaacatc
ctcacagcgagaaacgactcgtgcatgaagctgaccatcaccgaagtcttcactgcccca
aagaacacaagtgagaaggaaatcttctgcagagctgcaactgtgcttcagcagctctct
acacacaattgctccaacagattgctcagaggacttcacaggaacctcaggaacatggca
aacacgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg
ctaaaagtgatcatgcaacagaaatactacaggcactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141150
Entry
111141150         CDS       T05871                                 

Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04620  Toll-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04940  Type I diabetes mellitus
elk05133  Pertussis
elk05134  Legionellosis
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05162  Measles
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141150
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141150
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111141150
   04622 RIG-I-like receptor signaling pathway
    111141150
   04625 C-type lectin receptor signaling pathway
    111141150
   04658 Th1 and Th2 cell differentiation
    111141150
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141150
   05205 Proteoglycans in cancer
    111141150
  09163 Immune disease
   05321 Inflammatory bowel disease
    111141150
   05330 Allograft rejection
    111141150
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111141150
  09171 Infectious disease: bacterial
   05133 Pertussis
    111141150
   05134 Legionellosis
    111141150
   05152 Tuberculosis
    111141150
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111141150
   05164 Influenza A
    111141150
   05162 Measles
    111141150
   05168 Herpes simplex virus 1 infection
    111141150
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141150
   05145 Toxoplasmosis
    111141150
   05140 Leishmaniasis
    111141150
   05142 Chagas disease
    111141150
   05143 African trypanosomiasis
    111141150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141150
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141150
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141150
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111141150
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 fn3 Ig_4 I-set ig DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 111141150
NCBI-ProteinID: XP_022349217
UniProt: A0A2Y9IKL8
LinkDB
Position
Unknown
AA seq 329 aa
MHPWQLIISWISLGLLASPLMAIWELEKNVYVVELDWHPDAPGETVVLSCHTPEEDDITW
TSDQSSEVLGSGKTLTIQVKEFGDAGRYTCHKGGKVLSHSLLLIHKKEDGIWSTDILKEQ
KESKNKIFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSNRGLSDPQGVTCGAVTLSAERV
RVDNRDYKKYTVECQEGSACPAAEESLPIEVVVGAIHKLKYENYTSSFFIRDIIKPDPPR
NLQLKPLQNSRHVEVSWDYPDTWSTPHSYFSLTFCVQGQGKNNRDKKERLCVDKTSAKVT
CHKDAKIRVQARDRYYSSSWSNWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcacccttggcagctgatcatctcctggatttccctgggtttgctggcatctcccctc
atggccatttgggaactggagaaaaatgtttatgttgtagagttggattggcacccggac
gcccccggagaaacggtggtcctctcctgccatacccctgaagaagatgacatcacctgg
acctcagaccagagcagtgaagtcttaggctccggtaaaaccctgaccatccaagtcaaa
gaatttggagatgctggccggtatacctgtcataaaggaggcaaggttctgagccattcg
ctcctgctgattcacaaaaaggaagatggaatttggtccactgatatcttaaaggaacag
aaagaatccaaaaataagatctttctaaaatgtgaggcaaagaattattctggacatttc
acctgctggtggctgacagcaatcagtactgacttgaaattcagtgtcaaaagcaacaga
ggcctctctgacccccaaggggtgacgtgtggagcagtgacactctcagcagagagggtc
agagtggacaacagggattataagaagtacacggtggagtgtcaagagggcagtgcctgc
cctgccgctgaggagagcctgcccatcgaggtcgtggtgggtgctattcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccggacccgcccagg
aacctgcagctgaagcccttacaaaattctcggcatgtggaggtcagctgggattacccc
gacacctggagcaccccacattcctacttctccctgacgttctgcgtacagggccagggc
aagaacaatagggacaagaaagagagactctgcgtggacaagacctcagccaaggtcacg
tgccataaggatgccaagatccgcgtgcaagctcgagaccgctactatagctcatcctgg
agcaactgggcatctgtgtcctgcagttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141209
Entry
111141209         CDS       T05871                                 

Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04672  Intestinal immune network for IgA production
elk05200  Pathways in cancer
elk05310  Asthma
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141209
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141209
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141209
   04660 T cell receptor signaling pathway
    111141209
   04658 Th1 and Th2 cell differentiation
    111141209
   04657 IL-17 signaling pathway
    111141209
   04664 Fc epsilon RI signaling pathway
    111141209
   04672 Intestinal immune network for IgA production
    111141209
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141209
  09163 Immune disease
   05310 Asthma
    111141209
   05320 Autoimmune thyroid disease
    111141209
   05321 Inflammatory bowel disease
    111141209
   05330 Allograft rejection
    111141209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141209
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141209
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141209
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111141209
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 111141209
NCBI-ProteinID: XP_022349323
UniProt: A0A2Y9IL40
LinkDB
Position
Unknown
AA seq 134 aa
MRLLLHLSLLALGAAYVSVTAVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPENTNH
QLCIEEVFQGIDILKNQTAQAAAVDKLFRNLSFIKAHIDSQKKKCGGERWRVKKFLDYLQ
VFLGVINTEWTTES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagactgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact
gctgtagaaagtcccatgaacagactggtggcagagaccttgacactgctctccactcat
cgaactctgctgataggtgacgggaacctgatgattcctactcctgaaaatacaaatcac
caactgtgcatcgaagaagtctttcagggtatagacatattaaagaaccaaactgcacaa
gcagcggctgtggataaactattccgaaatttgtctttcataaaagcacatatagacagc
caaaaaaaaaaatgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141239
Entry
111141239         CDS       T05871                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04650  Natural killer cell mediated cytotoxicity
elk04657  IL-17 signaling pathway
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk05146  Amoebiasis
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05171  Coronavirus disease - COVID-19
elk05202  Transcriptional misregulation in cancer
elk05221  Acute myeloid leukemia
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141239
   04668 TNF signaling pathway
    111141239
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141239
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141239
   04650 Natural killer cell mediated cytotoxicity
    111141239
   04660 T cell receptor signaling pathway
    111141239
   04657 IL-17 signaling pathway
    111141239
   04664 Fc epsilon RI signaling pathway
    111141239
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111141239
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111141239
  09163 Immune disease
   05323 Rheumatoid arthritis
    111141239
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111141239
   05171 Coronavirus disease - COVID-19
    111141239
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141239
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111141239
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141239
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141239
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     111141239
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111141239
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111141239
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 111141239
NCBI-ProteinID: XP_022349369
UniProt: A0A2Y9IPV4
LinkDB
Position
Unknown
AA seq 153 aa
MWLQNLLFLGTVVCSISAPTSLPRPVTRPSRHVDAIQEALSLLNKSSDETAVMNEPVKVV
SGMFDRQEPTCLQTRLQLYSEGLRGSLISLKQPLTLMANHYKQHCLETPETPCAIQTITF
RSFKENLKEFLFNIPFDCWQPEATEAGPTRSQP
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttttcctgggcactgtggtctgcagcatctctgcacccacc
agcttacccagacctgtcactcgaccctctcggcacgtggatgccatccaagaggccctg
agccttctgaacaaaagtagtgatgagactgctgtgatgaatgaaccagtaaaagtcgtc
tctggaatgtttgaccgccaggagccgacatgcctgcagacgcgcctacagctgtacagt
gaaggcctgcggggcagcctcatcagcctcaagcaacccttaaccctgatggccaaccac
tacaagcagcactgcctcgaaaccccggaaactccctgtgcaatccagactatcaccttc
agaagtttcaaagaaaacctgaaggaatttctgtttaacatcccctttgactgctggcag
ccagaagcaacagaggccggtccaaccaggagccagccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141294
Entry
111141294         CDS       T05871                                 

Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04664  Fc epsilon RI signaling pathway
elk05200  Pathways in cancer
elk05310  Asthma
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141294
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141294
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111141294
   04657 IL-17 signaling pathway
    111141294
   04664 Fc epsilon RI signaling pathway
    111141294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141294
  09163 Immune disease
   05310 Asthma
    111141294
   05321 Inflammatory bowel disease
    111141294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141294
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141294
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 111141294
NCBI-ProteinID: XP_022349457
UniProt: A0A2Y9IL94
LinkDB
Position
Unknown
AA seq 131 aa
MALWLTVVIAFTCLSGLASPGPVRNLTTTKELIEELANITQNQASLCNGSMVWSVNRTTS
MYCAALESLISVSNCSAIHRTQRLLKSLCAQDTLAGQIPSERSQDTKIEVIQLVKNLLTY
ARGVFRHGNFP
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctggttgactgtggtcattgctttcacctgccttagtggccttgcctcccca
ggtcctgtgcgtaacttaacaaccaccaaggagctcattgaggaactggccaacatcacc
cagaatcaggcatccctttgcaatggcagcatggtatggagcgtcaaccggaccaccagc
atgtactgtgcagctctggaatctctgatcagtgtctccaactgcagcgccatccacagg
acccagaggttgctgaaatcactgtgtgctcaggataccttggcagggcagatccccagt
gagcgcagccaggacaccaaaattgaagtgatccagttggtgaaaaacctgctcacctat
gcacggggtgtttttcgccatggaaatttcccatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142126
Entry
111142126         CDS       T05871                                 

Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03050  Proteasome
elk04060  Cytokine-cytokine receptor interaction
elk04066  HIF-1 signaling pathway
elk04217  Necroptosis
elk04350  TGF-beta signaling pathway
elk04380  Osteoclast differentiation
elk04612  Antigen processing and presentation
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04940  Type I diabetes mellitus
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
elk05200  Pathways in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
elk05322  Systemic lupus erythematosus
elk05323  Rheumatoid arthritis
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    111142126
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111142126
   04630 JAK-STAT signaling pathway
    111142126
   04066 HIF-1 signaling pathway
    111142126
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111142126
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111142126
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111142126
   04612 Antigen processing and presentation
    111142126
   04660 T cell receptor signaling pathway
    111142126
   04658 Th1 and Th2 cell differentiation
    111142126
   04659 Th17 cell differentiation
    111142126
   04657 IL-17 signaling pathway
    111142126
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111142126
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142126
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111142126
  09163 Immune disease
   05322 Systemic lupus erythematosus
    111142126
   05323 Rheumatoid arthritis
    111142126
   05321 Inflammatory bowel disease
    111142126
   05330 Allograft rejection
    111142126
   05332 Graft-versus-host disease
    111142126
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111142126
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111142126
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111142126
  09172 Infectious disease: viral
   05160 Hepatitis C
    111142126
   05164 Influenza A
    111142126
   05168 Herpes simplex virus 1 infection
    111142126
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111142126
   05144 Malaria
    111142126
   05145 Toxoplasmosis
    111142126
   05140 Leishmaniasis
    111142126
   05142 Chagas disease
    111142126
   05143 African trypanosomiasis
    111142126
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:elk03051]
    111142126
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111142126
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111142126
Proteasome [BR:elk03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111142126
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111142126
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111142126
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 111142126
NCBI-ProteinID: XP_022350815
UniProt: A0A2Y9IY05
LinkDB
Position
Unknown
AA seq 166 aa
MNYTNYILAFQLCVIFCSSGYYCQAMFFKEIEDLKEYFNASNPDVADGGPLFLDILKNWR
EESDRTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLVRFFNSSSSKREDFLKLIR
IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSHSVFPGRRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaaactatatcttagcttttcagctttgcgtgattttctgttcttctggc
tattactgtcaggccatgttttttaaagaaatagaagacctaaaggaatattttaatgca
agtaatccagatgtagcagatggtgggcctcttttcttagatattttgaagaactggaga
gaggagagtgacagaacaatcattcaaagccaaattgtctctttctacttgaaactgttt
gaaaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg
cttgtcaggttcttcaatagcagcagcagtaagcgggaggacttccttaagctgattcga
attcccgtgaatgatctgcaggtccagcgcaaagcgataaatgaactcatcaaagtgatg
aatgatctctcaccaagatctaacctaaggaagcggaaaaggagtcacagtgtgtttccc
ggccgcagagcatcgaaataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142363
Entry
111142363         CDS       T05871                                 

Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142363
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111142363
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111142363
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111142363
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111142363
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111142363
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 111142363
NCBI-ProteinID: XP_022351097
UniProt: A0A2Y9IQV7
LinkDB
Position
Unknown
AA seq 178 aa
MAALQKSVNSSLLGALAASCLLIALWVQGGAAVPIGSHCRLANSDFEQPYITNRTFMLAG
EASLADNNTDVRLIGDTLFHGVNRGDRCYLMKEVLNFTLEEVLLPQSHRFQPYMQEVVPF
LTKLSNRLSQCHIDSDDQHIQRNVENLKDTVKKLGEDGEIKAIGELNLLFIALRDACI
NT seq 537 nt   +upstreamnt  +downstreamnt
atggctgccctgcagaaatctgtgaactcttcccttctgggagctctggctgccagctgc
ctcctcattgccctgtgggtgcagggaggagcagctgtgcccatcggctctcactgcagg
cttgccaactccgacttcgagcagccctatatcaccaaccgcaccttcatgctggctggg
gaggctagtttggcagataacaacacagatgttcgtctcattggggatacattgttccac
ggagtcaatagaggagaccgctgctatctgatgaaggaggtattgaactttacccttgaa
gaagtgctgctcccccaatcccatagattccagccctatatgcaggaggtggtgcccttc
ctgaccaagctcagcaacaggctaagccaatgtcatatcgacagtgatgaccagcatatt
cagagaaatgtggaaaacctgaaggacacagtgaaaaagcttggagaggatggagagatc
aaagcaattggagaactgaatttgctgtttatagccctgagagatgcctgcatttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147365
Entry
111147365         CDS       T05871                                 

Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01523  Antifolate resistance
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk04659  Th17 cell differentiation
elk04668  TNF signaling pathway
elk04672  Intestinal immune network for IgA production
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05010  Alzheimer disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05134  Legionellosis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05332  Graft-versus-host disease
elk05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111147365
   04668 TNF signaling pathway
    111147365
   04066 HIF-1 signaling pathway
    111147365
   04068 FoxO signaling pathway
    111147365
   04151 PI3K-Akt signaling pathway
    111147365
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111147365
   04061 Viral protein interaction with cytokine and cytokine receptor
    111147365
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111147365
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111147365
   04620 Toll-like receptor signaling pathway
    111147365
   04621 NOD-like receptor signaling pathway
    111147365
   04623 Cytosolic DNA-sensing pathway
    111147365
   04625 C-type lectin receptor signaling pathway
    111147365
   04659 Th17 cell differentiation
    111147365
   04657 IL-17 signaling pathway
    111147365
   04672 Intestinal immune network for IgA production
    111147365
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147365
   05202 Transcriptional misregulation in cancer
    111147365
  09163 Immune disease
   05323 Rheumatoid arthritis
    111147365
   05321 Inflammatory bowel disease
    111147365
   05332 Graft-versus-host disease
    111147365
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111147365
   05020 Prion disease
    111147365
   05022 Pathways of neurodegeneration - multiple diseases
    111147365
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111147365
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111147365
   04931 Insulin resistance
    111147365
   04933 AGE-RAGE signaling pathway in diabetic complications
    111147365
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111147365
   05135 Yersinia infection
    111147365
   05133 Pertussis
    111147365
   05134 Legionellosis
    111147365
   05152 Tuberculosis
    111147365
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147365
   05161 Hepatitis B
    111147365
   05171 Coronavirus disease - COVID-19
    111147365
   05164 Influenza A
    111147365
   05162 Measles
    111147365
   05168 Herpes simplex virus 1 infection
    111147365
   05163 Human cytomegalovirus infection
    111147365
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147365
   05169 Epstein-Barr virus infection
    111147365
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111147365
   05144 Malaria
    111147365
   05142 Chagas disease
    111147365
   05143 African trypanosomiasis
    111147365
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111147365
   01523 Antifolate resistance
    111147365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111147365
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111147365
SSDB
Motif
Pfam: IL6 IL11 GCSF
Other DBs
NCBI-GeneID: 111147365
NCBI-ProteinID: XP_022359074
UniProt: A0A2Y9JMJ8
LinkDB
Position
Unknown
AA seq 210 aa
MNSLSTSAFSPVAFSLGLLLVMATAFPTPGPLGGDSKDDATSNRPPLTSADKMEDFIKFI
LGKISALRNEMCDKYNKCEDSKEVLAENNLNLPKLAEKDRCFQSRFNQETCLTRITTGLQ
EFQLHLKYLESNYEGNKDNAHSVYISTKHLLQTLRPMNQIEVTTPDPTTDASLQALFKSQ
DKWLKHTTIHLILRRLEDFLQFSLRAIRIM
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaagcgccttcagtccagtggccttctctctgggactgctcctg
gtgatggctactgctttccctaccccgggacccctgggaggagattccaaagatgatgcc
acctcaaacagaccaccactcacctctgcagacaaaatggaagacttcattaagttcatc
cttggcaaaatctctgcactgagaaatgagatgtgtgacaagtataacaagtgtgaagac
agcaaggaggtgctggcagagaacaacctaaatcttccaaaactggccgaaaaggacaga
tgcttccagtctcgattcaatcaggagacctgtctgacaagaatcactaccggtcttcag
gagtttcagttacacctgaaatacctagagtccaactatgagggtaataaggacaatgcc
cactctgtgtacatcagcaccaaacacctgctccagacgctgaggcccatgaatcagatt
gaagtgaccacccccgaccctaccacagatgccagcctgcaggctctcttcaagtcgcag
gacaagtggctgaaacacacaacaattcacctcatcctacggagacttgaggatttcctg
cagttcagcctgagggccattcggatcatgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111148355
Entry
111148355         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111148355
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111148355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111148355
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111148355
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 111148355
NCBI-ProteinID: XP_022360563
UniProt: A0A2Y9JHR3
LinkDB
Position
Unknown
AA seq 185 aa
MLEKTAAPERRFSVDGKSLVRHQGGNGFPSTLPDALLLXLSVFFRKIFILQLVGLVLSYN
FTDCDFEKIRKKYQEVIYQALEKYMNGIKSTEFNNPIYCEDPPDCLTKIERITFYPTHGC
TSLAKEIFAIGTNATLTLQCPGYSGMQTNNTQAKKKRKKREVTTYKCREQVAYLMELWRR
FSRIS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgctagagaagaccgcagcccctgagaggcgatttagtgtggatggaaagagtttagtg
agacaccagggtggaaatgggtttccaagtacattgcctgatgctttattattgngtctt
tcagtttttttcaggaagatcttcatcttgcaactagtagggctggtgctatcctacaat
ttcactgactgtgactttgaaaagattagaaagaaatatcaggaagtcatttatcaagcc
ctggagaaatatatgaatgggatcaaaagcaccgaattcaacaatcccatctattgtgaa
gacccgccggattgccttactaaaatcgaacgcattaccttctatcccacccacggctgc
acgtctctcgccaaggaaatctttgcgataggaactaatgctacgctcactctccagtgc
ccaggctactccggaatgcagacaaataatacccaggcaaagaagaaaagaaagaaaaga
gaagtcacaacgtataaatgccgggaacaagttgcatacttaatggaactgtggcgtcgt
ttcagtcgtatttcttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111149196
Entry
111149196         CDS       T05871                                 

Definition
(RefSeq) interleukin-15
  KO
K05433  interleukin 15
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04668  TNF signaling pathway
elk04672  Intestinal immune network for IgA production
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111149196
   04668 TNF signaling pathway
    111149196
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111149196
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111149196
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149196
  09163 Immune disease
   05323 Rheumatoid arthritis
    111149196
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111149196
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111149196
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111149196
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 111149196
NCBI-ProteinID: XP_022361850
UniProt: A0A2Y9JVZ7
LinkDB
Position
Unknown
AA seq 161 aa
MRISKTYLRSTSIQCYLCLLLNCHFLTEAGIHVFILGSISAGLPKTEANWGFVIKDLEKI
DNIIQSIHIDTTLYTESDAHPGCKVTAMKCFLLELRVILLEFSHPDLNETIPNIIILANS
SLSSNANITETGCKECEELEEKNIKEFFRSFLHIVQMFYNS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaacatatttgagaagtacttccatccaatgctacttgtgtttactt
ttaaattgtcattttctaaccgaggctggcattcatgtcttcattttgggctctatcagt
gcaggtcttcctaaaacagaagcaaactgggggtttgtaataaaggatttggaaaaaatt
gacaatattattcaatctatacatattgataccactttatatactgaaagtgatgctcat
cccggctgcaaagtcacagcgatgaagtgctttctcctggagttacgtgttattttgctt
gagttcagtcatcctgaccttaatgaaacaatacctaacattatcatcctagcaaacagt
agtttatcttctaatgcgaacataactgaaacgggatgcaaagaatgtgaggaactggag
gagaaaaatattaaagaattttttcggagttttttacatattgtacaaatgttctataat
tcttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111150468
Entry
111150468         CDS       T05871                                 

Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04620  Toll-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04940  Type I diabetes mellitus
elk05133  Pertussis
elk05134  Legionellosis
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05152  Tuberculosis
elk05162  Measles
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111150468
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111150468
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111150468
   04622 RIG-I-like receptor signaling pathway
    111150468
   04625 C-type lectin receptor signaling pathway
    111150468
   04658 Th1 and Th2 cell differentiation
    111150468
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150468
  09163 Immune disease
   05321 Inflammatory bowel disease
    111150468
   05330 Allograft rejection
    111150468
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111150468
  09171 Infectious disease: bacterial
   05133 Pertussis
    111150468
   05134 Legionellosis
    111150468
   05152 Tuberculosis
    111150468
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111150468
   05164 Influenza A
    111150468
   05162 Measles
    111150468
   05168 Herpes simplex virus 1 infection
    111150468
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111150468
   05144 Malaria
    111150468
   05145 Toxoplasmosis
    111150468
   05140 Leishmaniasis
    111150468
   05142 Chagas disease
    111150468
   05143 African trypanosomiasis
    111150468
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111150468
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111150468
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111150468
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111150468
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 111150468
NCBI-ProteinID: XP_022363651
UniProt: A0A2Y9JSI4
LinkDB
Position
Unknown
AA seq 222 aa
MCPPRGLFLVTILVLLNHVDDLSLARNLPTASPSPGMFQCLNHSQNLLRAVSNTLRKAQQ
TLELYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKAS
FMTTLCLSSIYEDLKMYQVEFKAMNTKLLMDPKRQIFLDQSMLTAIDDLLQALNFNSATV
PQTSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgccgcgcggcctctttcttgtgaccatcttggtcctcctaaaccacgtggac
gacctcagtttggccaggaacctccccacagcctccccaagcccaggaatgttccagtgc
ctcaaccactcccaaaacctgctgagagctgtcagcaacacacttcggaaggcccaacaa
accctagaactttactcctgcacttccgaagagattgatcatgaagatatcacaaaggat
aaaaccagcaccgtggaggcctgcttaccgttggaattaaccatgaatgagagttgcctg
gcttccagagagatctctttgataactaatgggagttgcctggcctccagaaaggcctcc
tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaacacaaagcttttaatggatcctaagaggcagatctttctggatcaa
agcatgctgacggctattgatgacctgttgcaggccctgaatttcaacagtgcgactgtg
ccacagacatcttcccttgaagaaccagatttttataaaactaaaatcaagctctgcata
cttcttcatgctttcagaattcgtgccgtgaccatcgatagaatgatgagctatctgaac
tcttcctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111150936
Entry
111150936         CDS       T05871                                 

Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111150936
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111150936
   04061 Viral protein interaction with cytokine and cytokine receptor
    111150936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111150936
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111150936
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 111150936
NCBI-ProteinID: XP_022364339
UniProt: A0A2Y9JXT5
LinkDB
Position
Unknown
AA seq 176 aa
MKVSGLPICLLSAAFYLFWTPSAGLKTLHLGSCVITTNLQEMRNGFSEIRDSVQAKDEII
DTRILRKTESLQDTKPTDQCCLLRHVLRLYLDRVFKNFKTPDHHILRKTSSLANSFLTIK
KELRLCHAHMTCPCGEEATEKYSQILSHFEELMPQAAVVKALGELDILLQWMEEMK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagtttctggtcttccaatctgccttctctctgctgcattttatctcttctggaca
ccttctgctgggctgaagacactccatttgggaagctgtgtgatcaccacaaaccttcag
gaaatgcgaaatggattttctgagatacgagacagtgtgcaagccaaagatgaaatcatt
gataccagaatcttgaggaagactgagtctttgcaagacacaaagcctacagatcagtgc
tgcctcctccgccacgtactgagactctacctggacagggtattcaaaaactttaagact
cctgaccaccatatcctccggaagaccagcagtcttgctaactcttttcttaccattaag
aaggaactccggctctgtcatgcccatatgacatgcccttgtggagaggaagcaacagag
aaatacagccagattctgagtcacttcgaagagcttatgcctcaggccgcagtggtgaag
gctttgggagagctggacattctcctgcaatggatggaggagatgaaatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151003
Entry
111151003         CDS       T05871                                 

Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151003
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151003
   04061 Viral protein interaction with cytokine and cytokine receptor
    111151003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151003
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111151003
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 111151003
NCBI-ProteinID: XP_022364402
UniProt: A0A2Y9JTL2
LinkDB
Position
Unknown
AA seq 183 aa
MSFPGRTTALLGLSLTLLLCSQAPGVQGQEFQFGPCRVEGVVLQELWEAFWAMKDIVVTK
DNITSVRLLRKEILQNVSDVESCYLIRALLKFYLNTVFKNYLDKAADSRIRKSFSTLANN
FFVIASKLQPSQENDMFSISESARRRFLLFQRAFKQLDIQSAQTKAFGEVDILLTWMEKF
YQF
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagctttccagggcggacaactgccctcctcggcctgagtctgaccctgcttctctgc
agccaggctccaggggtccagggccaagaattccagttcggaccctgccgagtggagggt
gtagtcctccaggaactctgggaggccttctgggccatgaaggacattgtggtgactaag
gataacatcacgagtgtccggctgctacggaaggagattctgcagaacgtttcggacgtc
gagagctgttacctcatccgtgccctgctgaagttttacctgaataccgttttcaaaaac
tatctggataaggcagctgattccaggatccggaagtcattctcaactctggccaacaac
ttttttgtcatcgcctcaaaactgcaacccagtcaggaaaatgacatgttttctatcagt
gagagtgcacgccggcggtttctactgttccagagagcatttaaacagttggacatccaa
tcagcccagaccaaagcctttggagaagtggacattctcttgacctggatggagaaattc
taccagttctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151100
Entry
111151100         CDS       T05871                                 

Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04068  FoxO signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04660  T cell receptor signaling pathway
elk04672  Intestinal immune network for IgA production
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05144  Malaria
elk05145  Toxoplasmosis
elk05146  Amoebiasis
elk05150  Staphylococcus aureus infection
elk05152  Tuberculosis
elk05310  Asthma
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05322  Systemic lupus erythematosus
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151100
   04068 FoxO signaling pathway
    111151100
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151100
   04061 Viral protein interaction with cytokine and cytokine receptor
    111151100
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111151100
   04660 T cell receptor signaling pathway
    111151100
   04672 Intestinal immune network for IgA production
    111151100
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111151100
   05322 Systemic lupus erythematosus
    111151100
   05320 Autoimmune thyroid disease
    111151100
   05321 Inflammatory bowel disease
    111151100
   05330 Allograft rejection
    111151100
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111151100
   05133 Pertussis
    111151100
   05150 Staphylococcus aureus infection
    111151100
   05152 Tuberculosis
    111151100
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111151100
   05144 Malaria
    111151100
   05145 Toxoplasmosis
    111151100
   05140 Leishmaniasis
    111151100
   05142 Chagas disease
    111151100
   05143 African trypanosomiasis
    111151100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151100
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111151100
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111151100
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111151100
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 111151100
NCBI-ProteinID: XP_022364583
UniProt: A0A2Y9JUC2
LinkDB
Position
Unknown
AA seq 178 aa
MPSPALLCCLVLLAGVGASRHQSALSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK
LDSILLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPEVKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSAFSKLQERGVYKAMSEFDIFINYIETYMTMRMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagcccagcgctgctgtgttgcctggtcctgctggccggggtaggagccagccgc
caccagagtgccctgtctgaggacaactgcacccacttcccagccagcctgccccacatg
cttcgagagctccgagcagccttcggcagggtgaagactttctttcaaatgaaggacaag
ctggacagcatattgttgactgggtccttgctggaggactttaagggttacctgggttgc
caagccctgtcggagatgatccagttttacttggaggaggtgatgccccaggctgagaac
cacgacccagaagtcaaggagcacgtgaactcactgggggaaaagctgaagaccctgcgg
ctgaggctgcggcgctgtcatcgatttctgccctgtgagaataagagcaaggcggtggag
caggtgaaaagcgccttcagtaagctccaagagagaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaaacctacatgacaatgaggatgaagatctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151192
Entry
111151192         CDS       T05871                                 

Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151192
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111151192
   04061 Viral protein interaction with cytokine and cytokine receptor
    111151192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111151192
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111151192
SSDB
Motif
Pfam: IL10 IL22 DUF3829
Other DBs
NCBI-GeneID: 111151192
NCBI-ProteinID: XP_022364704
UniProt: A0A2Y9JYW0
LinkDB
Position
Unknown
AA seq 177 aa
MKAQRVSLWLVAAMFFLCSVHTRGLRRCLISMDIHHIEETFQEIKKTIQAKDTFQNVTIL
STPETLHSIKPLDVCCMTKNLLAFYVDKVFKDHQELNPQILRKISSIANSFLYMQKALQR
CQEQRQCHCRDEATNATRIIHDNYDQLEVRSAAIKLLGELDVFLAWIDKNHQGPSAA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggcacagcgtgtttccctctggctcgtggctgctatgttcttcctgtgctcagtg
cacacccgaggtctgagaaggtgtctgatctccatggacatacaccatatagaagagact
ttccaggaaatcaaaaaaaccatccaagctaaggacaccttccaaaatgttaccatcctg
tccacaccagagacgctgcatagcatcaagcccttagacgtatgctgcatgaccaagaac
ctcctggcattttacgtggacaaggtattcaaggaccatcaggagctgaacccccagatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaggctctgcaacga
tgtcaggagcagaggcagtgtcactgcagggatgaagccaccaatgccaccagaatcatc
cacgacaactatgatcagctggaggtccggtctgccgccattaagttgctgggagagctt
gacgtctttctagcctggattgacaagaatcatcaaggaccttctgcggcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154869
Entry
111154869         CDS       T05871                                 

Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04151  PI3K-Akt signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04672  Intestinal immune network for IgA production
elk04940  Type I diabetes mellitus
elk05135  Yersinia infection
elk05142  Chagas disease
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111154869
   04151 PI3K-Akt signaling pathway
    111154869
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111154869
   04061 Viral protein interaction with cytokine and cytokine receptor
    111154869
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154869
   04660 T cell receptor signaling pathway
    111154869
   04658 Th1 and Th2 cell differentiation
    111154869
   04659 Th17 cell differentiation
    111154869
   04672 Intestinal immune network for IgA production
    111154869
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154869
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111154869
   05321 Inflammatory bowel disease
    111154869
   05330 Allograft rejection
    111154869
   05332 Graft-versus-host disease
    111154869
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111154869
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111154869
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154869
   05171 Coronavirus disease - COVID-19
    111154869
   05162 Measles
    111154869
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111154869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111154869
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111154869
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111154869
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111154869
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 111154869
NCBI-ProteinID: XP_022370514
UniProt: A0A2Y9KGA6
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLSCIVLTLALVANSAPTTSSSTKEAQQQLEQLLLDLQLLLNGVNNYESLKLPRM
LTFKFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKG
SETSFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcatcgtactgactctcgcactcgtcgcaaacagt
gcacctactacttcaagctctacgaaggaagcacagcaacagctggagcaattgctgctg
gacttacagttgctcttgaatggggttaataattatgagagcctcaaactccccaggatg
ctcacatttaaattctacatgcccaagaaggccacagaattgactcatcttcaatgtcta
gcagaagaactcaaacttttggaggaagtgctatatttagctcaaagcaaaaactttcac
ttgacagacatcaaggaactaatgagcaatatcaatgtaacacttctgaaactaaaggga
tctgaaacaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156577
Entry
111156577         CDS       T05871                                 

Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04668  TNF signaling pathway
elk05135  Yersinia infection
elk05142  Chagas disease
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156577
   04668 TNF signaling pathway
    111156577
   04151 PI3K-Akt signaling pathway
    111156577
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156577
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156577
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156577
   04621 NOD-like receptor signaling pathway
    111156577
   04622 RIG-I-like receptor signaling pathway
    111156577
   04623 Cytosolic DNA-sensing pathway
    111156577
   04650 Natural killer cell mediated cytotoxicity
    111156577
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111156577
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111156577
   05152 Tuberculosis
    111156577
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156577
   05161 Hepatitis B
    111156577
   05160 Hepatitis C
    111156577
   05171 Coronavirus disease - COVID-19
    111156577
   05164 Influenza A
    111156577
   05162 Measles
    111156577
   05168 Herpes simplex virus 1 infection
    111156577
   05163 Human cytomegalovirus infection
    111156577
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156577
   05169 Epstein-Barr virus infection
    111156577
   05165 Human papillomavirus infection
    111156577
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111156577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156577
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156577
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111156577
NCBI-ProteinID: XP_022373272
UniProt: A0A2Y9KHG9
LinkDB
Position
Unknown
AA seq 186 aa
MTSRCILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK
IPEEIQKSQQFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLE
EILEDIMQEENFTWDHRTLLHLKRYYLRIVRYLKAKEYSVCAWTIVQAEILKSFFFLDKL
TDSLPN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccagcaggtgtatcctccaaactgctctcctggtatatttctccaccacggttctt
gccatgaactataacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag
ctccttctgcagttgaatggaacttctaaagattgcctcaaggacaggatgaacttcaag
atacctgaggagatccagaaatcccagcagttccagaaggaggacatcgtattggtcacc
cttgagatgttccagaagacctctgatattttcaggagaaatctctcaagcacgggatgg
aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag
gaaatcctggaagacatcatgcaggaggaaaacttcacttgggaccacaggacccttctg
cacctgaagagatattatctaaggatcgtgcggtacctgaaagccaaggagtacagcgtc
tgtgcctggacaatagtgcaagcagaaatcctcaagagctttttcttccttgataaactt
acagattctctccctaactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156578
Entry
111156578         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156578
   04151 PI3K-Akt signaling pathway
    111156578
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156578
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156578
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156578
   04621 NOD-like receptor signaling pathway
    111156578
   04622 RIG-I-like receptor signaling pathway
    111156578
   04623 Cytosolic DNA-sensing pathway
    111156578
   04650 Natural killer cell mediated cytotoxicity
    111156578
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156578
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156578
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156578
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156578
   05161 Hepatitis B
    111156578
   05160 Hepatitis C
    111156578
   05171 Coronavirus disease - COVID-19
    111156578
   05164 Influenza A
    111156578
   05162 Measles
    111156578
   05168 Herpes simplex virus 1 infection
    111156578
   05163 Human cytomegalovirus infection
    111156578
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156578
   05169 Epstein-Barr virus infection
    111156578
   05165 Human papillomavirus infection
    111156578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156578
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156578
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111156578
NCBI-ProteinID: XP_022373273
UniProt: A0A2Y9KJK1
LinkDB
Position
Unknown
AA seq 185 aa
MALSISVLLALVMLGSSPARSLDCVLHPSHGNLETFPLLSQMERISILSCLKDRTDFSFP
QMLVDGSKFEKTEATAVTHEMLRQIFSLFSQRGSLVAWDETLLDKFLAGLHQQLDDLETC
LEEEKNVEQLPQGSENSRLAVKRYFRGISLYLEKKEYSRCAWEVVRMEIRRCLFFVSELT
RKLRK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctctccatctctgtgctgctggccctggtgatgctgggctccagcccagcccgc
tctctggactgtgtcctgcatccaagccatggcaatctggaaaccttcccactgttgagt
cagatggagagaatctccattctgtcctgtctgaaggataggactgacttcagctttcct
cagatgcttgtggatgggagcaagtttgagaagacagaagccacagctgtcacgcatgag
atgctccggcagatcttcagccttttcagccaaaggggctccctggtggcttgggacgag
accctactggacaaattcctcgctggacttcatcagcagctggatgacctggagacatgt
ttggaggaagaaaagaacgtggaacagttaccccagggaagtgagaactccagactggct
gtgaagagatacttccgtggaatcagtctctatcttgaaaagaaagaatacagccgctgt
gcctgggaggttgtccggatggaaatcagaaggtgcttgttcttcgtcagtgagctcaca
aggaaactcaggaaataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156593
Entry
111156593         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156593
   04151 PI3K-Akt signaling pathway
    111156593
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156593
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156593
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156593
   04621 NOD-like receptor signaling pathway
    111156593
   04622 RIG-I-like receptor signaling pathway
    111156593
   04623 Cytosolic DNA-sensing pathway
    111156593
   04650 Natural killer cell mediated cytotoxicity
    111156593
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156593
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156593
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156593
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156593
   05161 Hepatitis B
    111156593
   05160 Hepatitis C
    111156593
   05171 Coronavirus disease - COVID-19
    111156593
   05164 Influenza A
    111156593
   05162 Measles
    111156593
   05168 Herpes simplex virus 1 infection
    111156593
   05163 Human cytomegalovirus infection
    111156593
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156593
   05169 Epstein-Barr virus infection
    111156593
   05165 Human papillomavirus infection
    111156593
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156593
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156593
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156593
NCBI-ProteinID: XP_022373286
UniProt: A0A2Y9KI83
LinkDB
Position
Unknown
AA seq 198 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLLNWRALMLLRQMRRVSPFSCLRDRNDFA
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACPLQEAGVGEMPLVNGDSILRNYFQRISLYLQEKQYSPCAWETVRAEIMKAFSSSTTLQ
ERLRGKKRDLVQHGDDSH
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaccatggtctgctgaactggagggccttgatgctc
ctgcgacaaatgaggagagtctcccctttttcctgcctgagggacagaaatgactttgcc
ttcccccaagaggtgtttgacggcaagcagctacagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccctgg
aacacgaccctcctggaggaattgtgctcaggactttctgagcagctgggccacctggaa
gcctgtccccttcaggaggcgggggtgggagagatgcccctggtgaatggggactccatc
ctgaggaactacttccaaagaatctccctctatctgcaagagaagcaatacagcccttgt
gcctgggagacggtcagagcagagatcatgaaagctttctcttcatcaacaaccttgcaa
gaaaggttaaggggcaagaaacgagacctggttcaacatggtgatgactctcactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156594
Entry
111156594         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156594
   04151 PI3K-Akt signaling pathway
    111156594
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156594
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156594
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156594
   04621 NOD-like receptor signaling pathway
    111156594
   04622 RIG-I-like receptor signaling pathway
    111156594
   04623 Cytosolic DNA-sensing pathway
    111156594
   04650 Natural killer cell mediated cytotoxicity
    111156594
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156594
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156594
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156594
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156594
   05161 Hepatitis B
    111156594
   05160 Hepatitis C
    111156594
   05171 Coronavirus disease - COVID-19
    111156594
   05164 Influenza A
    111156594
   05162 Measles
    111156594
   05168 Herpes simplex virus 1 infection
    111156594
   05163 Human cytomegalovirus infection
    111156594
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156594
   05169 Epstein-Barr virus infection
    111156594
   05165 Human papillomavirus infection
    111156594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156594
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156594
SSDB
Motif
Pfam: Interferon ubiquitin PORR
Other DBs
NCBI-GeneID: 111156594
NCBI-ProteinID: XP_022373287
UniProt: A0A2Y9KHI3
LinkDB
Position
Unknown
AA seq 159 aa
MALPCSFLVALVMLSCPSLGSLGCDLSQDHGLLHWRALMLLRQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEDSPAPWNTTLLEELCSGLSEQLGHLE
ACPLQEAGVGETPLVNGDSILRNYFQRMPLWLRNLYMFY
NT seq 477 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtgatgctcagctgcccctccctcggc
tctctgggatgtgacctgtctcaggaccacggcctgctgcactggagggccttgatgctc
ctgcgacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgatggtaagcagctgcagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggactcacctgctccgtgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggaggcgggggtgggagagacacccctggtgaatggggactccatc
ttgaggaactacttccagagaatgcctttgtggttaagaaatttgtatatgttttac

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156604
Entry
111156604         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156604
   04151 PI3K-Akt signaling pathway
    111156604
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156604
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156604
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156604
   04621 NOD-like receptor signaling pathway
    111156604
   04622 RIG-I-like receptor signaling pathway
    111156604
   04623 Cytosolic DNA-sensing pathway
    111156604
   04650 Natural killer cell mediated cytotoxicity
    111156604
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156604
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156604
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156604
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156604
   05161 Hepatitis B
    111156604
   05160 Hepatitis C
    111156604
   05171 Coronavirus disease - COVID-19
    111156604
   05164 Influenza A
    111156604
   05162 Measles
    111156604
   05168 Herpes simplex virus 1 infection
    111156604
   05163 Human cytomegalovirus infection
    111156604
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156604
   05169 Epstein-Barr virus infection
    111156604
   05165 Human papillomavirus infection
    111156604
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156604
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156604
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156604
NCBI-ProteinID: XP_022373302
UniProt: A0A2Y9KHJ9
LinkDB
Position
Unknown
AA seq 182 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLLHWRALMLLQQMRRVSPFSCLRDRNDFA
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEAPPASWNTTLLEELCSGLSEQLGHLE
ACPLQETPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALHKRLKS
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaccatggcctgctgcactggagggccttgatgctc
ctgcaacaaatgaggagagtctcccctttttcctgcctgagggacagaaatgactttgcc
ttcccccaagaggtgtttgacggcaagcagctacagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggccccacctgcttcctgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggagacacccctggtgaatggggactccatcctgaggaactacttc
cagagaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtc
cgagcagagatcatgaaacccttgtatgcatcaacagccttgcataagagattaaagagc
aagaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156606
Entry
111156606         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156606
   04151 PI3K-Akt signaling pathway
    111156606
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156606
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156606
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156606
   04621 NOD-like receptor signaling pathway
    111156606
   04622 RIG-I-like receptor signaling pathway
    111156606
   04623 Cytosolic DNA-sensing pathway
    111156606
   04650 Natural killer cell mediated cytotoxicity
    111156606
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156606
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156606
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156606
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156606
   05161 Hepatitis B
    111156606
   05160 Hepatitis C
    111156606
   05171 Coronavirus disease - COVID-19
    111156606
   05164 Influenza A
    111156606
   05162 Measles
    111156606
   05168 Herpes simplex virus 1 infection
    111156606
   05163 Human cytomegalovirus infection
    111156606
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156606
   05169 Epstein-Barr virus infection
    111156606
   05165 Human papillomavirus infection
    111156606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156606
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156606
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156606
NCBI-ProteinID: XP_022373304
UniProt: A0A2Y9KPP3
LinkDB
Position
Unknown
AA seq 142 aa
MHKRRCSEKIEPRVPDVPTPARTTASAGSLLQQMRRLPASPCDNYTNDFGFPQEAFDGKQ
LQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLEELCSGIYQRVNDLEACLMQEAGVG
ETPLVNGDSILRNYFQRIYLYL
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagatagagccacgggtcccagacgtgcccacccca
gccaggacaacagcatctgctggatccctcctgcaacaaatgaggagactgcctgctagc
ccctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgacggcaagcag
ctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctccctggaacacgaccctcctggaggaattgtgctca
ggaatttatcagcgggtgaacgacctagaagcctgtctcatgcaggaggcgggggtggga
gagacgcctctcgtgaatggggactccatcctgaggaactacttccagagaatctacctc
tatctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156609
Entry
111156609         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156609
   04151 PI3K-Akt signaling pathway
    111156609
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156609
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156609
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156609
   04621 NOD-like receptor signaling pathway
    111156609
   04622 RIG-I-like receptor signaling pathway
    111156609
   04623 Cytosolic DNA-sensing pathway
    111156609
   04650 Natural killer cell mediated cytotoxicity
    111156609
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156609
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156609
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156609
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156609
   05161 Hepatitis B
    111156609
   05160 Hepatitis C
    111156609
   05171 Coronavirus disease - COVID-19
    111156609
   05164 Influenza A
    111156609
   05162 Measles
    111156609
   05168 Herpes simplex virus 1 infection
    111156609
   05163 Human cytomegalovirus infection
    111156609
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156609
   05169 Epstein-Barr virus infection
    111156609
   05165 Human papillomavirus infection
    111156609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156609
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156609
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111156609
NCBI-ProteinID: XP_022373309
UniProt: A0A2Y9KPP8
LinkDB
Position
Unknown
AA seq 217 aa
MHKRRCSENLEPRVPDMPTPARPTASAGSPMALLCSFLVALVVLSCHSLGSLGCDLPQDH
SLLNWRALMLLRQMRRISLISCDKYTNDFAFSKKVFDSKQLQKAQALSVIYVMNQKTFHL
FCTEASPAPWNTTLLEELCSGIYQRVNDLEACLMQEAGVGEMPLVNGDSILRNYFQRIYL
YLRKKQYSPCAWEMVRAEIMKPLYASTILQERLRSKQ
NT seq 654 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaatctagagccacgggtcccagacatgcccacccca
gccaggccaacagcatctgcaggatctcccatggccctgctgtgctccttcttggtggcc
ctggtggtgctcagctgccactccctcggctctctgggatgtgacctgcctcaggaccac
agcctgctgaactggagggccttgatgctcttgagacaaatgaggagaatctcccttatc
tcttgtgacaagtacacaaatgactttgctttctccaagaaggtatttgacagcaagcag
ctgcagaaggctcaagccctctctgtcatctatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctccctggaacacgaccctcctggaggaattgtgctca
ggaatttatcagcgggtgaacgacctagaagcctgtctcatgcaggaggcgggggtggga
gagatgcccctcgtgaatggggactccatcctgaggaactacttccagagaatctacctc
tatctgcgaaagaagcaatatagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacgatcttgcaagaaagattaaggagcaagcaatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156814
Entry
111156814         CDS       T05871                                 

Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156814
   04151 PI3K-Akt signaling pathway
    111156814
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156814
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111156814
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156814
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111156814
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111156814
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111156814
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 111156814
NCBI-ProteinID: XP_022373603
UniProt: A0A2Y9KKF9
LinkDB
Position
Unknown
AA seq 158 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKEGREYQHVLMISINDLDTMIKNRTNCPN
NEPKVLKKHACDDNKEGIFLYRAAHKLKQFVKVNDSEDFNLHLLRVSQGTLQLLNCTPKE
DNKSVKEQRKQKSLCSLGILLQKIKTCWNKILRGSKEH
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcgtccgattgtgacattgaaggtaaagagggcagagagtatcagcacgtc
ctaatgatcagcatcaacgacttggacaccatgataaaaaatcgtaccaattgcccgaac
aatgaacctaaagttttaaaaaaacatgcatgtgatgataataaggaaggtatattttta
tatcgtgctgctcacaagttgaagcagtttgtgaaagtgaatgacagtgaggatttcaat
ctccacttattaagagtttcacagggcacattacaattgttgaactgtacccccaaggaa
gacaataaatctgtaaaggaacagagaaaacagaagagcttgtgttccctagggatacta
ctacaaaagataaaaacttgttggaataaaattttgaggggctctaaagaacattga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157589
Entry
111157589         CDS       T05871                                 

Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157589
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157589
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111157589
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    111157589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111157589
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111157589
SSDB
Motif
Pfam: IL15 IL4
Other DBs
NCBI-GeneID: 111157589
NCBI-ProteinID: XP_022374842
UniProt: A0A2Y9KLP3
LinkDB
Position
Unknown
AA seq 153 aa
MRSSAGNMEKIVICLMVIFLGTVAHKSSFQEQDRLLIRLRQLIDIVDQLKDNLNDLDNES
LPAPEDVKRHCEWSAFSCFQTAQLKAANTGGNEQKIKVLTKQLKRKLPLTNADKGQIHRP
TCPSCDSYEKTPPKEFLERLKSLIQRMIYQHLS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagatccagtgctggcaacatggagaagatagtcatctgcctgatggtcatcttcttg
gggacagtggcccataaatcaagcttccaagagcaagatcgcctcttgattagattgcgt
cagcttatagatattgttgatcagctgaaagataatctgaatgacttggacaatgaatct
ctgccagctccagaggatgtaaagagacattgtgagtggtcagctttttcatgttttcag
acagcccaactaaaggcagcaaacacaggaggcaatgagcagaaaataaaagtattaacg
aaacagctgaagaggaaactacctctcacaaatgcagacaaaggacagatacacagacca
acatgcccctcatgtgattcttatgagaaaacaccacccaaagaattcctagaaagactg
aaatcgctcatccaaaggatgatttatcagcatctctcctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159843
Entry
111159843         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon epsilon
  KO
K05442  interferon epsilon
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04622  RIG-I-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159843
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159843
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111159843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159843
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159843
SSDB
Motif
Pfam: Interferon ORC2
Other DBs
NCBI-GeneID: 111159843
NCBI-ProteinID: XP_022378208
UniProt: A0A2Y9KYN9
LinkDB
Position
Unknown
AA seq 207 aa
MINKHFFAIVLVLLASSTLFSLELKLALFQQRVNRXSLKLFNKFPKSSVQLCLPHRTNFL
LPQQSVNRRWSQSGQALAILHEMLLQTFNLFRAGISLDGWEESLVENFLTELHQQLEYLG
ALRGLGAEQNSCVLSGGNPRLQVKKYFRKIHDYLENQEXSSCTWTIVXVEINRCLFFAFQ
LVRKLSKQETDSFQVEQEPSPGFKSIG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgattaacaagcatttctttgcaattgtgttggtgctcttggcctcttctactctcttc
tcccttgaattgaaactggctctcttccaacaaagagtaaacagatagagtttaaaactg
ttcaataaattcccaaaatcgtcagttcagctgtgtctgccacacaggacaaacttcctc
cttccccagcagtctgtgaatcgtcgctggtcccagagtggacaggccctggccattctg
catgagatgcttctgcagaccttcaacctcttcagggcaggtatttctctggatggttgg
gaggaaagcctcgtggagaatttcctcactgaacttcatcaacagctggaatacctaggg
gccctcagaggcctgggagcagagcagaacagctgtgtcttgagtggtgggaaccctagg
ttacaggttaaaaagtatttccggaagatccacgattacctggaaaaccaggagtaaagc
agctgcacctggaccattgtttgagtagaaatcaaccggtgtctgttctttgcattccag
ttggtaagaaagctaagcaaacaagaaacagattccttccaagtggagcaagagccatct
ccaggctttaaaagcatagggtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159856
Entry
111159856         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159856
   04151 PI3K-Akt signaling pathway
    111159856
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159856
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159856
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159856
   04621 NOD-like receptor signaling pathway
    111159856
   04622 RIG-I-like receptor signaling pathway
    111159856
   04623 Cytosolic DNA-sensing pathway
    111159856
   04650 Natural killer cell mediated cytotoxicity
    111159856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159856
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159856
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159856
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159856
   05161 Hepatitis B
    111159856
   05160 Hepatitis C
    111159856
   05171 Coronavirus disease - COVID-19
    111159856
   05164 Influenza A
    111159856
   05162 Measles
    111159856
   05168 Herpes simplex virus 1 infection
    111159856
   05163 Human cytomegalovirus infection
    111159856
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159856
   05169 Epstein-Barr virus infection
    111159856
   05165 Human papillomavirus infection
    111159856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159856
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159856
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159856
NCBI-ProteinID: XP_022378214
UniProt: A0A2Y9L3M4
LinkDB
Position
Unknown
AA seq 187 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLMHWRALMILRQMRRLSASSCDNYTNDFG
FPQEVFGGKQLQKAQALSFIHVTSQKTFHLFCTEASPAPWNTTFLEELCSGLSEQLGHLE
ACPLQEAGVGETPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALQ
ERLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgccctgctcctttttggtggccctggtggtgctcagctgccactccctcggt
tctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggcgttgatgatc
ctgcgacaaatgaggagactgtctgctagctcctgtgacaactacacaaatgactttggc
ttcccccaggaggtgttcggtggcaagcagctgcagaaggctcaagccctctctttcatc
catgtgacgagccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccttcctggaggaattgtgctcaggactttctgagcagctgggacacctggaa
gcctgtcccctgcaggaggcgggggtgggagagacacccctggtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcgagagaaacaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaacagccttgcaa
gaaagactaaggagaaagaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159858
Entry
111159858         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159858
   04151 PI3K-Akt signaling pathway
    111159858
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159858
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159858
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159858
   04621 NOD-like receptor signaling pathway
    111159858
   04622 RIG-I-like receptor signaling pathway
    111159858
   04623 Cytosolic DNA-sensing pathway
    111159858
   04650 Natural killer cell mediated cytotoxicity
    111159858
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159858
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159858
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159858
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159858
   05161 Hepatitis B
    111159858
   05160 Hepatitis C
    111159858
   05171 Coronavirus disease - COVID-19
    111159858
   05164 Influenza A
    111159858
   05162 Measles
    111159858
   05168 Herpes simplex virus 1 infection
    111159858
   05163 Human cytomegalovirus infection
    111159858
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159858
   05169 Epstein-Barr virus infection
    111159858
   05165 Human papillomavirus infection
    111159858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159858
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159858
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159858
NCBI-ProteinID: XP_022378217
UniProt: A0A2Y9KW00
LinkDB
Position
Unknown
AA seq 187 aa
MALSCSFLVAPVVLTCHSLGSLGCDLPQDHGLMHWRALMLLRHMRRLSASSCDKYTNDFG
FPQEVFGGKQLQKAQALSVIHVMNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGRLE
ACPLQEAGVGETALMNGDSILRNYYQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALH
KRLRSGK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgtcctgctccttcttggtggccccggtggtgctcacctgccactcccttggc
tctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggccttgatgctc
ctgcgacacatgaggagactgtctgctagctcctgtgacaagtacacaaatgactttggc
ttcccccaggaggtgtttggtggcaagcagctgcagaaggctcaagctctctctgtcatc
catgtgatgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccgcctggaa
gcctgtcccctgcaggaggcgggggtgggagagacagcactcatgaatggggactccatc
ttgaggaactactaccagagaatctccctctatctgcgagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaacagccttgcat
aagagactaaggagtgggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159859
Entry
111159859         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159859
   04151 PI3K-Akt signaling pathway
    111159859
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159859
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159859
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159859
   04621 NOD-like receptor signaling pathway
    111159859
   04622 RIG-I-like receptor signaling pathway
    111159859
   04623 Cytosolic DNA-sensing pathway
    111159859
   04650 Natural killer cell mediated cytotoxicity
    111159859
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159859
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159859
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159859
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159859
   05161 Hepatitis B
    111159859
   05160 Hepatitis C
    111159859
   05171 Coronavirus disease - COVID-19
    111159859
   05164 Influenza A
    111159859
   05162 Measles
    111159859
   05168 Herpes simplex virus 1 infection
    111159859
   05163 Human cytomegalovirus infection
    111159859
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159859
   05169 Epstein-Barr virus infection
    111159859
   05165 Human papillomavirus infection
    111159859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159859
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159859
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111159859
NCBI-ProteinID: XP_022378218
UniProt: A0A2Y9KYQ0
LinkDB
Position
Unknown
AA seq 209 aa
MFREPRATGPRRAHPTPSVGSPMALPCSFLVALVVLSCHSLGSLGCDLPQDHGLMHWRAL
MLLQQMKRLSASSCDKYTNDFGFPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEASPA
PWNTTLLGELCSGLSEQLGLLEACPLQEAGVGEMPLMNGDSILRNYFQRISLYLQEKQYS
PCAWEMVRAETMKPLYASMALHKRLQSRK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttcagagaacctagagccacgggtcccagacgtgcccaccccaccccatctgtagga
tcccccatggccctgccctgctccttcttggtggccctggtggtgctcagctgccactcc
cttggctctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggccttg
atgctcctgcaacaaatgaagagactgtctgctagctcctgtgacaagtacacaaatgac
tttggcttcccccaggaggtgtttgatggcaagcagctgcagaaggctcaagccctctct
gtcgtccatgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgct
ccttggaacacgaccctcctgggggaattgtgctcgggactttctgagcagctgggcctc
ctggaagcctgtcccctgcaggaggcgggagtaggagagatgcccctcatgaatggggac
tccatcctgaggaactacttccagagaatctccctctatctacaagagaagcaatacagc
ccttgtgcctgggagatggtccgagcagagaccatgaaacccttgtatgcatcaatggcc
ttgcataagagattgcagagcaggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159861
Entry
111159861         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159861
   04151 PI3K-Akt signaling pathway
    111159861
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159861
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159861
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159861
   04621 NOD-like receptor signaling pathway
    111159861
   04622 RIG-I-like receptor signaling pathway
    111159861
   04623 Cytosolic DNA-sensing pathway
    111159861
   04650 Natural killer cell mediated cytotoxicity
    111159861
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159861
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159861
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159861
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159861
   05161 Hepatitis B
    111159861
   05160 Hepatitis C
    111159861
   05171 Coronavirus disease - COVID-19
    111159861
   05164 Influenza A
    111159861
   05162 Measles
    111159861
   05168 Herpes simplex virus 1 infection
    111159861
   05163 Human cytomegalovirus infection
    111159861
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159861
   05169 Epstein-Barr virus infection
    111159861
   05165 Human papillomavirus infection
    111159861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159861
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159861
SSDB
Motif
Pfam: Interferon PORR
Other DBs
NCBI-GeneID: 111159861
NCBI-ProteinID: XP_022378219
UniProt: A0A2Y9L3M9
LinkDB
Position
Unknown
AA seq 179 aa
MPTPARPTASVGSPMALPCSFLVALVVLSCHFLGSLGCDLPQDHGLLHWRALMLLQRMKR
LSASSCDKYTNDFGFPQEVFDSKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLE
ELCSGLSEQLGHLEACPLQEAGVEEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMV
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccaccccagccaggccaacagcatctgtaggatcccctatggccctgccctgctcc
ttcttggtggccctggtggtgctcagctgccacttcctcggctctctgggatgtgacctg
cctcaggaccatggcctgctgcattggagggccttgatgctcctgcaacgaatgaagaga
ctgtctgctagctcctgtgacaagtacacaaacgactttggcttcccccaggaggtgttt
gacagcaagcagctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaag
accttccacctcttctgcacagaggcctcacctgctccttggaacacgactctcctggag
gaattgtgctcgggactttctgagcagctgggccacctggaagcctgtcccctgcaggaa
gctggggtagaagagatgcccctggtgaatggggactccatcctgaggaactacttccag
agaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159862
Entry
111159862         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159862
   04151 PI3K-Akt signaling pathway
    111159862
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159862
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159862
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159862
   04621 NOD-like receptor signaling pathway
    111159862
   04622 RIG-I-like receptor signaling pathway
    111159862
   04623 Cytosolic DNA-sensing pathway
    111159862
   04650 Natural killer cell mediated cytotoxicity
    111159862
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159862
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159862
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159862
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159862
   05161 Hepatitis B
    111159862
   05160 Hepatitis C
    111159862
   05171 Coronavirus disease - COVID-19
    111159862
   05164 Influenza A
    111159862
   05162 Measles
    111159862
   05168 Herpes simplex virus 1 infection
    111159862
   05163 Human cytomegalovirus infection
    111159862
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159862
   05169 Epstein-Barr virus infection
    111159862
   05165 Human papillomavirus infection
    111159862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159862
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159862
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159862
NCBI-ProteinID: XP_022378220
UniProt: A0A2Y9IJA3
LinkDB
Position
Unknown
AA seq 228 aa
MHKRRCSEKLEPRVPDMPTSARPTTSVGSPMALPCSFLVLLVVLTCHSLGSLGCDLPQDH
GLVPWRALMLLQRMKRLSASSCDNYTNDFGFPQEAFDGKQLQKAQALSVIHVMNQKTFHL
FCTEASPAPLNTTLLEELCSGLSEQLGRLEACPLQEAGVGETPFVNGDSILRNYFQRISL
YLQEKQYSPCAWEMVRAEIMKPLYASTALHKRLRSRKGHPFQRGNGSL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagctagagccacgggtcccagacatgcccacctca
gcgaggccaacaacatctgtaggttcccccatggccctgccctgctccttcttggtgctc
ctggtggtgctcacttgccactccctcggctctctgggatgtgacctgcctcaggaccac
ggcctggtgccctggagggccttgatgctcctgcaacgaatgaagagactgtctgctagc
tcctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgatggcaagcag
ctgcagaaggctcaagccctctctgtcatccatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctcctttgaacacgacactcctggaggaattgtgctcg
ggactttctgagcagctgggccgcctggaagcctgtcccctgcaggaggcgggggtggga
gagacgcccttcgtgaatggggactccatcttgaggaactacttccagagaatctccctc
tatctgcaagagaagcaatacagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacagccttgcataagagattgcggagcaggaagggacacccc
tttcaacgtggaaatggttctctctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159868
Entry
111159868         CDS       T05871                                 

Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04622  RIG-I-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159868
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159868
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111159868
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159868
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159868
SSDB
Motif
Pfam: Interferon Tsi6 CREPT DUF892
Other DBs
NCBI-GeneID: 111159868
NCBI-ProteinID: XP_022378228
UniProt: A0A2Y9KYR0
LinkDB
Position
Unknown
AA seq 208 aa
MSTKPNVIRKCLWPACLVGLLITGILSLDCNLLHFYLRKVTWQNLRLLSSTSSSFPAECL
SETKAFELPQEILSHTQPVKRYIKEAFYEMSIQAFNIFSQYTLKSTWESDDLKQIQIGLD
QQLQYLEQCLEEEEKEKEDLKEMTEDGMNWSGALVPQLSSLELRRYFNRIDNFLKEKRHS
HCAWEIIRAEIRRCFYYFQKFAALLKKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagcactaagcctaatgtgattcggaagtgtttgtggcctgcatgccttgtgggtctg
ctcatcactggcatcctctctctggactgtaacttgctgcatttctacctgaggaaagtc
acctggcaaaacctgagacttctgagcagtacgagcagctcctttcctgcagagtgcctg
agcgaaaccaaagcgtttgagttgccccaagagatcctgtcacacacccagcctgtgaaa
aggtacatcaaggaggccttctatgaaatgtctatacaggccttcaacatcttcagtcag
tacaccctcaaatccacttgggaaagcgacgatctgaaacaaatccaaatcggactcgat
cagcagctgcagtacttggaacaatgcctggaggaagaggagaaggaaaaggaagacttg
aaagagatgacagaagatgggatgaactggtcaggagctctggtcccccagctgagcagc
ctagaactgaggagatatttcaataggatagacaacttcctgaaagaaaagagacacagt
cactgtgcctgggaaatcatccgagcggaaatcagaagatgtttctactactttcagaaa
tttgcagccctactcaagaagaaataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159932
Entry
111159932         CDS       T05871                                 

Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04657  IL-17 signaling pathway
elk04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159932
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159932
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111159932
   04659 Th17 cell differentiation
    111159932
   04657 IL-17 signaling pathway
    111159932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159932
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111159932
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 111159932
NCBI-ProteinID: XP_022378327
UniProt: A0A2Y9KWC1
LinkDB
Position
Unknown
AA seq 202 aa
MLVVGVLLALGPGRAAGALRANRRPTRPRGCADRPEELLEQLYGRLAAGVLGAFHHTLQL
GPREQARNASCPAGGRPGDRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAYCLCRGCL
TGLFGEEDLRFRSAPVYVPTVILRRTSACAGGRSVYTEEYVTVPVGCTCVPEQEKEADSI
NSSMDKQGAKLLLSPSNKPGRP
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctggtggtcggcgtcctgctggcgttggggcctggccgggccgcaggtgccctgagg
gcgaacagacgcccgacgcggccgcggggctgcgccgaccggcccgaggagctcctggag
cagctgtacgggcggctggcggcgggcgtgctcggcgccttccaccacacgctgcagctg
gggccgcgcgagcaagcgcgtaatgcgagctgcccggcagggggcaggccgggcgaccgg
cgcttccggccgcccaccaacctgcgcagcgtgtcgccgtgggcctacagaatttcctac
gaccccgccaggtacccgaagtacctgcccgaggcctactgcctgtgcaggggctgcctg
accgggctgttcggcgaggaggacctgcgtttccggagcgccccggtgtacgtgcccacc
gtcatcctgcggcggacctcggcgtgcgcgggcggccgctcggtgtacaccgaggagtat
gtcacggtgccggtgggctgcacgtgcgtccccgagcaggagaaggaagcggacagcatc
aactccagcatggacaagcagggcgccaagctcctgctcagccccagcaacaagccgggc
cggccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160020
Entry
111160020         CDS       T05871                                 

Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111160020
   04151 PI3K-Akt signaling pathway
    111160020
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111160020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111160020
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111160020
SSDB
Motif
Pfam: LIF_OSM CENP-Q
Other DBs
NCBI-GeneID: 111160020
NCBI-ProteinID: XP_022378494
UniProt: A0A2Y9L4E7
LinkDB
Position
Unknown
AA seq 237 aa
MRAQLMWRTLPSLVLGLLFLSTPVMGSCLDKDQELLRQLQKQADIMQRTSMLLNPYIQSQ
GLDKDGLKEHCRERPGTFPSKEALQRLSRQEFLRALDTMLDHVLHRLKALQRDIPKAQDL
ETLNRAKQNIRGFKNNIHCLAQLLPGSSETTEPAPIGPGTSPSPTPTPDTFQRRLEGCRF
LHGYHRFMHSVGQVFREWAESPSRSRRHSPRRGLRKGTRRVPLSRNKRLLPRVQLPW
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcgggcacagcttatgtggaggacgctgcccagtctggtcctcggacttctgttcttg
agcacgccggtcatgggcagctgtctggacaaggaccaagagctgctcaggcagctccag
aagcaggcggacatcatgcagcgaaccagcatgctcctgaacccctatatccaaagccaa
ggcctagacaaggatggactgaaggagcactgccgggagcgcccagggaccttccccagc
aaagaggccctgcagcggctcagcaggcaggaattcctgcgggctctcgacaccatgctg
gaccacgttctgcacagactgaaggccttgcagcgagacatccccaaagcccaggacctg
gagacactgaatagggcaaagcagaacattcgcgggttcaagaacaatatccactgcctg
gcccagctgcttccaggctcatcagagacgactgagcccgctccaataggcccagggaca
tctccgtcgcccacccccaccccagacaccttccagcgcaggctcgaaggctgcaggttc
ctgcacggctatcaccgcttcatgcactccgtggggcaggtgtttcgagagtgggcggag
agcccgagtcggagccggagacacagcccccgccggggcctgcggaaggggacccgcaga
gtgccactctccaggaacaagagactcctgcccagggttcagctgccctggtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160085
Entry
111160085         CDS       T05871                                 

Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
elk04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111160085
   04668 TNF signaling pathway
    111160085
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111160085
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111160085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111160085
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111160085
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 111160085
NCBI-ProteinID: XP_022378613
UniProt: A0A2Y9KZU4
LinkDB
Position
Unknown
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCHSNLMNQIRNQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKTRLVELYRIIAYLGASLGNIT
RDQKVLNPNALSLHSKLNATADILRGLLSNVLCRLCNKYHVAHVDVAYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVVAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggaaacacgga
gcagggagcccccttcccatcaccccagtcaacgccacctgcgccacccgccacccatgt
cacagcaacctcatgaaccagatcaggaaccaactggcacagctcaatggcagtgccaat
gctctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctgtgtggccccaatgtgacagacttcccgccattccacgccaacggcacggagaaaacg
cggctcgtggagctctaccgtatcatcgcgtaccttggcgcctccctgggcaacatcact
cgggaccagaaggtcctcaatcccaacgccctcagcctccacagcaagttgaacgccacg
gcggacatcctgcggggcctcctcagcaatgtgctctgccgcctgtgtaacaagtaccac
gtggcccacgtggacgtggcctatggccctgacacctcgggcaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtataagcaggtcattgccgtggtggcccag
gccttctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160242
Entry
111160242         CDS       T05871                                 

Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk05133  Pertussis
elk05152  Tuberculosis
elk05200  Pathways in cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111160242
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111160242
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111160242
   04659 Th17 cell differentiation
    111160242
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160242
  09163 Immune disease
   05323 Rheumatoid arthritis
    111160242
   05321 Inflammatory bowel disease
    111160242
  09171 Infectious disease: bacterial
   05133 Pertussis
    111160242
   05152 Tuberculosis
    111160242
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111160242
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111160242
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 111160242
NCBI-ProteinID: XP_022378871
UniProt: A0A2Y9KYY5
LinkDB
Position
Unknown
AA seq 193 aa
MLGSRVLMLLLPLLLLPPLPWLAETRAVPEGGRPAWVRGQQLSQQLCTLAWSTHPHVDLP
REEEDDETTQEVPRIQCEDGCDPQGLEDNSQFCLQRIHQGLVFYEKLLGSDIFTGESSSL
PNGPVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRFKILRSLQAFVAVA
ARVFAHGAATLSP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctggggagcagggttctgatgctgctcttgccgctgctgctgctgccaccgctgccc
tggctggctgagacccgagccgtgcctgagggcggtcgccctgcctgggtccggggccag
cagctctcacagcagctctgcacgctggcctggagcacacatcctcatgtggacttacca
agagaagaggaagatgatgagactacacaggaggtcccccgcatccagtgtgaggatggc
tgtgatccccaaggactcgaagacaacagtcagttctgcttacaaaggatccaccagggc
ctggttttttatgagaagctgctgggctcagacattttcacaggggagtcttcttcactc
cccaacggccctgtgggccagcttcacgcctccctcctgggtctgaggcaactcttgcag
cctgagggtcaccactgggagactgagcaaactccaagccccagtcccagccagccatgg
cagcgcctccttctccgcttcaagatccttcgcagcctccaggcctttgtggctgtagct
gcccgggtctttgcccatggagcagcaaccctgagcccctaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161564
Entry
111161564         CDS       T05871                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161564
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111161564
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111161564
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111161564
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 111161564
NCBI-ProteinID: XP_022381013
UniProt: A0A2Y9L6P2
LinkDB
Position
Unknown
AA seq 196 aa
MKLDMAMGCLPVLIAMVLTRTEAIPGPNPLGVFPDAGGCHLAQFQSLSPQELQAFKKAKD
TFEESLSLKAWSCRPRLFPRTWDLQQLQVWERPVALEAEVALTLKVLETMADRSLGSILD
QPLHTLRHIQSELQACVEAQPPAGPRPRGRLHHWLHRLHEAPKKEPLGCLETSVMFNLFR
LLTRDLKCVASGDLCV
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaagctggatatggccatgggctgcctgccggtgctgatagctatggtgctgacccgg
acggaagcaattcctggccccaatcccctcggggtcttccccgatgcagggggctgccac
ttggcccagttccagtctctgtccccgcaagagctgcaggccttcaagaaggccaaggac
acctttgaagagtcactctccctgaaggcttggagctgccgcccccgcctcttccccagg
acctgggacctacagcagctgcaggtgtgggagcgccccgtggccctggaggccgaggtg
gccttgaccctaaaggtcctggagaccatggctgacaggtccctggggagcatcctggac
cagccccttcacacgctgcgccacatccagtctgagctccaggcctgtgtggaagctcag
cccccagcagggccccggccccgaggccgcctccaccactggctgcaccggcttcacgag
gccccaaagaaggagcccctcggctgcctggaaacctctgtcatgttcaacctctttcgc
ctccttacccgggacctgaaatgcgtggccagtggagacctgtgtgtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161574
Entry
111161574         CDS       T05871                                 

Definition
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161574
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111161574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111161574
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111161574
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 111161574
NCBI-ProteinID: XP_022381024
UniProt: A0A2Y9LBQ4
LinkDB
Position
Unknown
AA seq 189 aa
MAMAWVLLLVTAGLSMATAGPVPTSKPATTWKGCDIGRFKSLSPRELKSFKMAKDALENS
LKNWSCISRLFPTNRDLRQLQVWERPVALEAELTLTLKVLETMADRSQGGILDQPLHTLR
HIHSELQDCVKAQPIVGPQPRGRLHHWLHRLHEASKKESQGCLEASVLFNLFRLLKKDLE
CVASGDLCV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccatggcgtgggtcctgctgctggtaactgcagggctaagcatggccacagctggc
cccgtccccacttctaagcccgccacaacctggaagggctgtgacatcggcaggttcaaa
tctctgtcaccacgggagctgaaatccttcaagatggccaaggatgccttggaaaattca
ctaaaaaactggagttgcatctcccgcctcttccctacaaaccgggacctgagacagctg
caggtgtgggagcgccccgtggccttggaggctgagctgaccttgaccctaaaggtcctg
gagaccatggctgataggtcccaggggggcatcctggaccagcccctacacactctgcgc
catatccactctgagctccaggactgtgtcaaggctcagcccatagtaggccctcagccc
cgaggccgcctccaccactggctgcatcggcttcatgaggcctcaaagaaggagtctcaa
ggctgcctcgaggcctctgtcctgttcaacctctttcgcctcctcaaaaaggacctggaa
tgtgtcgccagtggagacctgtgtgtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162204
Entry
111162204         CDS       T05871                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162204
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111162204
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111162204
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 111162204
NCBI-ProteinID: XP_022382142
UniProt: A0A2Y9L7E0
LinkDB
Position
Unknown
AA seq 201 aa
MIEAPFCLLTLLLLPLSPGAPITPAEPISQAYSLALYMQKNTSALLQTYLQHQGSPFSDP
GFSAPELQLSSLPPAAVSFKTWHALDDGERLSHAQGAFLALTQHLQLVGDDQRDLNPGSP
ILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGVVPFQASAFERKCRGYVVTRE
YGHWTDRAVRDLALLKAKYPG
NT seq 606 nt   +upstreamnt  +downstreamnt
atgatagaagccccgttctgcctgctgacgctgctgctgctgcccctcagtccaggggcc
cccatcaccccagctgagcccatcagtcaggcctacagcctggccctctacatgcagaag
aatacatcagcactgctgcagacttatctccagcaccagggcagccccttcagtgaccct
ggcttctcagcccccgagcttcagctcagcagcctgcctcctgccgccgtctccttcaag
acctggcatgccctggatgacggggagcggctgagccatgcccagggggccttcctggcc
ttgacccagcacctccagctcgtgggggacgaccagcgagaccttaaccctggcagtcct
atcctgctggctcagctcggggctgcaagactcagggcccaaggcctgctgggcaacatg
gctgccatcatgaccgccctgggcctgcccatcccccctgaagaggacactcttggggtt
gtccccttccaggcctcagcctttgagaggaaatgtcgaggctatgtagtgacccgggaa
tatggccactggacagaccgagctgtgagggacttggctctgctcaaggccaagtaccct
ggatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162344
Entry
111162344         CDS       T05871                                 

Definition
(RefSeq) cardiotrophin-1 isoform X1
  KO
K05422  cardiotrophin 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162344
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111162344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111162344
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111162344
SSDB
Motif
Pfam: PRF pPIWI_RE_X
Other DBs
NCBI-GeneID: 111162344
NCBI-ProteinID: XP_022382417
UniProt: A0A2Y9L8C1
LinkDB
Position
Unknown
AA seq 205 aa
MSRREGSLEDPQADSSISPLPHLEAKIRQTHSLARLLTKYAEQLLQEYVQYQGDPFGLPG
FSPPRLPVAGLSAPAPGHAGLPTPERLRLDAAALTALPPLLEVVRRHQAELNPRAPRLLL
RLEEAARQARALAAGVEAVLAALGADETRGPRPEPAVVATNAAAAVTDAGVFPAKVLGLR
VCGLYREWVSRTEGDLGQLVPGGPA
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagatccacaggctgactcctccatctcacccctt
ccccacttggaggccaagatccgtcagacacacagccttgcccgcctcctcaccaaatat
gctgagcagctgctccaggaatatgtgcagtaccagggagaccccttcgggctgcccggc
ttctcgcccccgcgactgccggtggccggcctgagcgccccggcacccggccacgcgggc
ctgcccacccccgagcggctgcggctggacgccgcggcgctcaccgcgctgccgccgctg
ctcgaggtggtgcggcgccaccaggccgaactgaacccgcgcgccccgcgcctgctgctg
cgcctggaggaggcggcgcgccaggcccgggccctggccgccggggtggaggccgtgctg
gccgcgctgggcgccgacgagacccgcgggccccggccggagcccgccgtcgttgccacc
aacgccgcagctgccgtcaccgacgcgggcgtcttccctgccaaggtgttggggctccgc
gtgtgcggcctctaccgcgagtgggtgagccgaaccgagggcgacctgggccagctggtg
cccgggggcccggcctga

DBGET integrated database retrieval system