KEGG   Enhydra lutris kenyoni (northern sea otter): 111139664
Entry
111139664         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q8 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111139664
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111139664
   04145 Phagosome
    111139664
  09143 Cell growth and death
   04218 Cellular senescence
    111139664
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111139664
   04612 Antigen processing and presentation
    111139664
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111139664
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111139664
   05330 Allograft rejection
    111139664
   05332 Graft-versus-host disease
    111139664
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111139664
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111139664
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111139664
   05170 Human immunodeficiency virus 1 infection
    111139664
   05168 Herpes simplex virus 1 infection
    111139664
   05163 Human cytomegalovirus infection
    111139664
   05167 Kaposi sarcoma-associated herpesvirus infection
    111139664
   05169 Epstein-Barr virus infection
    111139664
   05165 Human papillomavirus infection
    111139664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111139664
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111139664
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111139664
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111139664
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2
Other DBs
NCBI-GeneID: 111139664
NCBI-ProteinID: XP_022347698
UniProt: A0A2Y9IGG5
LinkDB
Position
Unknown
AA seq 480 aa
MLLLLQLWRLLPESAAVLILLTLLPEPDLILDFPTAALGPRPPVTQMLESLSAQTGNPWG
LPVVADGPASLAKMVMAELTNLKLENKPWPGGTHSLHYHYLALSEPGPDLPQFLAVGYVD
DQPFIHYDSRVDRAKPQAPWMATVDAQYWETETQKQRAWAKVQLVETWTVMGYHNQSTGM
HSTQRMFGCEIREDGHTHSFWQFGFDGQDHLSLDLETLNWVSAKPAAMRTKSWWETERCY
AEYDKAYLEGLCLVSLRRYLELGGQSLTRKGISTDTEPNRMWRERVKELAHVTIEDREFQ
DLQLASRRPRRASVSVSVHRQEKTDVPAAGDQAGEPPMVQVTRHTDPDGCITLKCWARGF
YPRDISLSWWLGEEELVLETEYVETRPSGDGTYQMWAAVQVPARTEDQYTCHVQHSGLNH
TLTVTWEAPPRQWITSAVVIPIFIFLLLTAGVLIFIKQYSQGGEDPPVSPVRVEAAQLLC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctgctgctcctgcagctgtggcgtctattgccggagagcgcggcagttttaattctt
ctgacattgctacccgagcctgacctcatcctggatttccccaccgctgccttggggcct
cgccctcctgtcacacagatgctggaaagcttatcagcacagacggggaacccctggggg
ttgcccgtggtggccgatggcccagcttccttagcgaagatggtgatggcagaactaacc
aacctaaagttagaaaacaagccatggcctggagggacacactctctccactaccactac
ctggccctgtcagagccaggcccggaccttccccagtttctggctgtaggctacgtggat
gaccagcccttcatccattatgacagtcgtgtggacagggccaagccccaggccccgtgg
atggcaactgtggacgcccagtactgggagacagagactcagaagcagagagcctgggca
aaggtgcagctggtggagacgtggaccgtgatgggctaccacaaccagagcactggcatg
cacagcacccagcggatgttcggctgtgagatccgggaggacggccacacccacagcttc
tggcagtttggctttgatgggcaggaccacctgtcactggacctggagactctgaactgg
gtgtcagccaaacctgcagccatgcggaccaagagctggtgggagacagagcgctgctac
gctgagtacgacaaggcctacctggaaggcctctgcctcgtttccctgcgcaggtacctg
gagctgggcggccagagcctcacccggaaaggaatctccacagacacagaaccaaacaga
atgtggagagagagagttaaggaattggctcacgtgaccatagaggaccgggagttccaa
gatctgcagctggcaagccggagacccaggagagccagtgtttcagtttcagtccataga
caggaaaagactgatgtcccagctgcaggagatcaggcaggagagccgcccatggtgcag
gtgacaagacacacagacccggatggctgcatcacactgaaatgctgggcccggggcttc
tacccacgggacatctcattgagctggtggctgggtgaggaggagctggtgctagagact
gagtatgtggagacacgccccagtggagatggcacctaccagatgtgggcggctgtgcag
gtgccagccaggacggaggaccagtacacttgccatgtgcagcactctggcctgaaccac
acactcactgtgacctgggaagcaccccctcgtcagtggataaccagtgctgtggttatc
cccatatttatctttctcttgctgacggctggagtgttgatcttcatcaagcagtactct
caaggtggagaggaccctccagtgagcccagtgagagtggaggctgctcagctgctctgc
tga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152201
Entry
111152201         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DLA class I histocompatibility antigen, A9/A9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152201
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152201
   04145 Phagosome
    111152201
  09143 Cell growth and death
   04218 Cellular senescence
    111152201
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111152201
   04612 Antigen processing and presentation
    111152201
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152201
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111152201
   05330 Allograft rejection
    111152201
   05332 Graft-versus-host disease
    111152201
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111152201
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111152201
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152201
   05170 Human immunodeficiency virus 1 infection
    111152201
   05168 Herpes simplex virus 1 infection
    111152201
   05163 Human cytomegalovirus infection
    111152201
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152201
   05169 Epstein-Barr virus infection
    111152201
   05165 Human papillomavirus infection
    111152201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111152201
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111152201
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111152201
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111152201
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C MHC_I_3 Ig_3 ig C2-set_2 Ig_2 RAMP MATalpha_HMGbox EphA2_TM FeoB_associated
Other DBs
NCBI-GeneID: 111152201
NCBI-ProteinID: XP_022366304
UniProt: A0A2Y9K3R7
LinkDB
Position
Unknown
AA seq 361 aa
MEVVMPRTLLLLLWGALAVTETWAGSHSLRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDSASQRMEPRAPWVEQEGPEYWDRQTRNLKDAAQTHRVNLNTLRGYYNQSEAGSHNIQ
SMSGCDVGPDGRLLRGYSQXAYDGADYIALNQDLRSWTAADTAAQITRRKWEAAGAAEQL
RNYLEGTCVEWLRRYLENGKETLLRAEPPNTHVTRHPISDHDVTLRCWALGFYPAEITLT
WQRDEEDLIQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPVTLRWEP
PPRTIILTLIIAGLVLLVVTAVIGTVIWRKKHSGEKGPGYSHAARDDSPQGSDVSLMAPK
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaggtcgtgatgccccgaaccctcctcctgctgctgtggggggcgctggccgtgacc
gagacctgggcgggctcccactccctgaggtatttcgacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatctccgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgactctgccagtcagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccggcagacccggaacctcaaggacgccgcacagactcaccgagtg
aacctgaacaccctgcggggctactacaaccagagcgaggccgggtctcacaacatccag
agcatgtccggctgtgacgtggggcccgacgggcgcctcctccgcggatacagtcagntt
gcctacgacggcgcggattacatcgccctgaaccaggacctgcgctcctggaccgcggcg
gacacagcggcgcagatcacccgccgcaagtgggaggcggccggtgcggcagagcagctg
aggaactacctggagggcacgtgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctactgcgcgcagaaccccccaacacacatgttacccgccaccccatctccgac
catgatgtcaccctgaggtgttgggctctgggcttctaccctgcagagatcaccctgacc
tggcagcgagatgaagaggacctgatccaggacacagagcttgtggagaccaggcctgca
ggagatggaaccttccagaagtgggtggctgtggtggtaccttctggacaggagcaaaga
tacacatgccacgtgcagcatgaggggctgcccaagcctgtcaccttgagatgggagcca
cctcctcgcaccatcatcctcacgttgatcattgctggtctggttctcctggtggtcact
gcagtgattggaactgtgatctggaggaagaagcactcaggagaaaaaggaccaggctac
tctcatgctgcacgtgatgacagtccccagggctctgatgtgtctctcatggctcctaaa
gtatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152203
Entry
111152203         CDS       T05871                                 

Definition
(RefSeq) DLA class I histocompatibility antigen, A9/A9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152203
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152203
   04145 Phagosome
    111152203
  09143 Cell growth and death
   04218 Cellular senescence
    111152203
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111152203
   04612 Antigen processing and presentation
    111152203
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152203
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111152203
   05330 Allograft rejection
    111152203
   05332 Graft-versus-host disease
    111152203
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111152203
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111152203
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152203
   05170 Human immunodeficiency virus 1 infection
    111152203
   05168 Herpes simplex virus 1 infection
    111152203
   05163 Human cytomegalovirus infection
    111152203
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152203
   05169 Epstein-Barr virus infection
    111152203
   05165 Human papillomavirus infection
    111152203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111152203
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111152203
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111152203
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111152203
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 ig Ig_2 C2-set_2 MATalpha_HMGbox GAPT VSP DUF3827
Other DBs
NCBI-GeneID: 111152203
NCBI-ProteinID: XP_022366305
UniProt: A0A2Y9KA02
LinkDB
Position
Unknown
AA seq 361 aa
MEVMMPRTLLLLLWGALAVTETRAGSHSLRYFDTAVSRPGRGEPRFIVVGYVDDTQFVRF
DSDSASQRMEPRAPWVEQEGPEYWDRETRTCKSAAQTYRVSLQNVLGYYNQSEAGSHNIQ
RMYGCEVGPDGRLLRGYSQDSYDGADYIALNQDLRSWTAADTAAQITRRKWEAAGAAEQL
RNYLEGTCVEWLRRYLENGKETLLRAEPPNTHVTRHPISDHDVTLRCWALGFYPAEITLT
WQRDEEDLTQDTELVETRPAGDGTFQKWVAVAVPSGQEQRYTCHVQHEGLPKPVTLRWEP
SSPTIPITWIIAVLVLLVVTAVIGVVIWWKKCSGEKGPGYSHAARDDSAQGSDVSLTIPK
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaggtcatgatgccccgaaccctcctcctgctgctgtggggggcgctggccgtgacc
gagacccgggcgggatcccactccctgaggtatttcgacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatcgtcgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgactctgccagtcagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacgcggacctgcaagagcgccgcacagacttaccgagtg
agcctgcagaacgtcctgggctactacaaccagagcgaggccgggtctcacaacatccag
cgcatgtacggctgtgaagtggggcccgacgggcgcctcctccgcgggtacagtcaggac
tcctacgacggcgcggattacatcgccctgaaccaggacctgcgctcctggaccgcggcg
gacacagcggcgcagatcacccgccgcaagtgggaggcggccggtgcggcagagcagctg
aggaactacctggagggcacgtgcgtggagtggctccgcaggtacctggagaacgggaag
gagacgctactgcgcgcagaaccccccaacacacatgttacccgccaccccatctccgac
catgatgtcaccctgaggtgttgggctctgggcttctaccctgcggagatcaccctgacc
tggcagcgagatgaagaggacctgacccaggacacagagcttgtggagaccaggcctgca
ggagatggaaccttccagaagtgggtggctgtggcggtaccttctggacaggagcaaaga
tacacatgccacgtgcagcatgaggggctgcccaagcctgtcaccttgagatgggagcca
tcttctcccaccatccccatcacgtggatcattgctgtcctggttctcctggtggtcact
gcagtgattggagttgtgatctggtggaagaagtgctcaggagaaaaaggaccaggctac
tctcatgctgcacgcgatgacagtgcccagggctctgatgtatctctcacgattcctaaa
gtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152204
Entry
111152204         CDS       T05871                                 

Definition
(RefSeq) DLA class I histocompatibility antigen, A9/A9 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152204
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152204
   04145 Phagosome
    111152204
  09143 Cell growth and death
   04218 Cellular senescence
    111152204
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111152204
   04612 Antigen processing and presentation
    111152204
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152204
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111152204
   05330 Allograft rejection
    111152204
   05332 Graft-versus-host disease
    111152204
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111152204
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111152204
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152204
   05170 Human immunodeficiency virus 1 infection
    111152204
   05168 Herpes simplex virus 1 infection
    111152204
   05163 Human cytomegalovirus infection
    111152204
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152204
   05169 Epstein-Barr virus infection
    111152204
   05165 Human papillomavirus infection
    111152204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111152204
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111152204
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111152204
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111152204
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Ig_2 C2-set_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 111152204
NCBI-ProteinID: XP_022366306
UniProt: A0A2Y9JZL5
LinkDB
Position
Unknown
AA seq 361 aa
MGSPVLLLLLSGALAVTETWAGSHSLRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSD
SASRRMEPRAPWMEQEGPEYWDRQTRNLKDAAQSFRVNLNTLRGYYNQSEAGSHTIQSMY
GCDVGPDGRLLRGYSQFAYDGADYLALNQDLRSWTVADTAAQITRRKWEAAGAAEHERDY
LEVTCVEWLLRYLENGKETLLRVEPPNTHVTRHPISDHDVTLRCWALGFYPAEITLTWQR
DGEDLTQDTELVETRPAGDGTFQKWVAVAVPSGQEQRYTCHVQHEGLPKPVTLRCKPPPP
TNLITWIIAGLGLLGLLMVTAVIGAVIWWKKCSGEKGPGYSHAARNDSALGSDVSLMAAK
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggggtccccagtcctcctcttgctcctgtcgggggcgctggccgtgaccgagacctgg
gcgggctcccactccttgaggtatttcgacaccgcggtgtcccggcccggccgcggggag
ccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgac
tctgccagtcggaggatggagccgcgggcgccgtggatggagcaggaggggccagagtat
tgggaccggcagacccggaacctcaaggacgccgcacagagtttccgagtgaacctgaac
accctgcggggctactacaaccagagcgaggccgggtctcacaccatccagagcatgtac
ggctgtgacgtggggcccgacgggcgcctcctccgcgggtacagtcagttcgcctacgat
ggcgcggattacctcgccctgaaccaggacctgcgctcctggacggtggcagacacagcg
gcgcagatcacccgccgcaagtgggaggcggccggtgcggcagagcatgagagggactac
ctggaggtcacgtgcgtggagtggctcctcaggtacctggagaacgggaaggagacgctg
ctgcgcgtagaaccgcccaacacacatgttacccgccaccccatctccgaccatgatgtc
accctgaggtgttgggctctgggcttctaccctgcggagatcaccctgacctggcagcga
gatggagaggacctgacccaggacacagagcttgtggagaccaggcctgcaggagatgga
accttccagaagtgggtggctgtggcggtaccttctggacaggagcagagatacacatgc
catgtgcagcatgaggggctgcccaagcctgtcaccttgagatgcaagccacctcctcct
accaacctcatcacatggatcattgctggtctgggtctcctgggtctcctcatggtcact
gcagtgattggagctgtgatctggtggaagaagtgctcaggagaaaaaggaccaggctac
tctcatgctgcacgtaatgatagtgccctgggctctgatgtgtctctcatggctgctaaa
gtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152405
Entry
111152405         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-36 alpha chain
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152405
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152405
   04145 Phagosome
    111152405
  09143 Cell growth and death
   04218 Cellular senescence
    111152405
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111152405
   04612 Antigen processing and presentation
    111152405
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152405
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111152405
   05330 Allograft rejection
    111152405
   05332 Graft-versus-host disease
    111152405
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111152405
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111152405
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152405
   05170 Human immunodeficiency virus 1 infection
    111152405
   05168 Herpes simplex virus 1 infection
    111152405
   05163 Human cytomegalovirus infection
    111152405
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152405
   05169 Epstein-Barr virus infection
    111152405
   05165 Human papillomavirus infection
    111152405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111152405
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111152405
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111152405
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111152405
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 MATalpha_HMGbox C2-set_2
Other DBs
NCBI-GeneID: 111152405
NCBI-ProteinID: XP_022366638
UniProt: A0A2Y9K007
LinkDB
Position
Unknown
AA seq 330 aa
GVLALTETRTGSHSLRYLFTVVSRPGRGEPRYLERSYVDDTQFAQFDSDSASLKMEPRAP
WVEQEGLEYWDQQTRDSRTCTQTLXGRLGEVGGYYNQSEAGLHTFQRVIGCDVGPDGRFL
RGYLRDAYDGVDHIALNKDLCSWTEADSTAQITRLKWEATGVAQRYRNYMEGRCMEWLHR
HLEKGKEMLLRTEPPNTHVTRHPISDHDVTLRCWALGFHPVEITLTWQHDEEDLTQDTEL
VETKPTGDGTFQKWAAVVVPSGEEQRYMCHVQHKGMSQPITLRWEPPPEPTIPIMGTIAA
LVLVVTGAVVVGTVMWRKKHSGRKGSGRGI
NT seq 993 nt   +upstreamnt  +downstreamnt
ggggtcctggccctgacggagaccaggacgggctcccactccctgaggtatttgttcact
gtggtgtcccggcctggccgcggggagccccggtatttggaacgcagctacgtggacgac
acgcagttcgcgcagtttgacagcgactctgccagtctgaagatggagccgcgggcaccg
tgggtggagcaggaggggctggagtattgggaccagcagacccgggactccaggacgtgc
acacagacactctaagggaggctgggagaagtgggcggctactacaaccagagcgaggcc
gggcttcacaccttccagagagtgataggctgcgacgtggggcctgatgggcgctttctg
cgcgggtaccttcgtgatgcctatgatggcgtggatcacatcgccctgaataaggacctg
tgctcctggaccgaggcagactccaccgcgcagatcacccgtctgaagtgggaggcgact
ggtgtggcccagcggtacaggaactacatggagggcagatgcatggagtggctccacagg
cacctggagaaggggaaggagatgcttctgcgcacagaaccccccaacacacatgtgacc
cgccaccccatctctgaccatgatgtcaccctgaggtgttgggccctgggcttccaccct
gtggagatcactctgacctggcagcatgatgaggaggacctgacccaggacacagagctt
gtggagaccaagcccacaggggatggaaccttccagaagtgggcggctgtagtggtgccc
tctggagaggagcagagatacatgtgccatgtgcagcacaaggggatgtcccagcccatc
accttgagatgggagccgccacctgagcctaccatccccatcatgggcaccattgctgcc
ctggttcttgtggtcactggagctgtggtggtgggaactgtgatgtggaggaagaagcac
tcaggtaggaaagggagtgggaggggaatttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152501
Entry
111152501         CDS       T05871                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain G-like isoform X1
  KO
K06751  MHC class I antigen
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04218  Cellular senescence
elk04514  Cell adhesion molecules
elk04612  Antigen processing and presentation
elk04940  Type I diabetes mellitus
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111152501
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111152501
   04145 Phagosome
    111152501
  09143 Cell growth and death
   04218 Cellular senescence
    111152501
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111152501
   04612 Antigen processing and presentation
    111152501
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152501
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111152501
   05330 Allograft rejection
    111152501
   05332 Graft-versus-host disease
    111152501
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111152501
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111152501
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152501
   05170 Human immunodeficiency virus 1 infection
    111152501
   05168 Herpes simplex virus 1 infection
    111152501
   05163 Human cytomegalovirus infection
    111152501
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152501
   05169 Epstein-Barr virus infection
    111152501
   05165 Human papillomavirus infection
    111152501
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111152501
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
    111152501
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111152501
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elk00537]
 Antigens
  111152501
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig MATalpha_HMGbox Ig_2
Other DBs
NCBI-GeneID: 111152501
NCBI-ProteinID: XP_022366681
UniProt: A0A2Y9K0L5
LinkDB
Position
Unknown
AA seq 436 aa
MGPRTLALLLSGALAVAEIWAGSHYLRYFSTAVSRPGRGEPRYWEVGYVDDSQFARFDSD
SASRRMEPRAPWVEQEGPEYWDQETRRVKHNAQAFQVSLNTLRGYYNQSEAGSHTFQWTY
ACDVGAHGRLLRGYQQWAYDGADYIALNEDLRSWTAADTAAQITLRKWEVAGEAERYRNY
LEVTCVEWLRRHLENGKETLLRSKPPNTHVTHHPISDRDVILRCWALGFYPVEITLTWQR
EGEDLTQDTELVETRPAGDGTFQKWAAVVVPSREEQRYTCHVQHEGLSEPITLRWEPPLP
IVLITWIIAGLVVAVVIGAVIWRKKCSGSHGLCYNLTVVSQDESVHRRIFAERHLDGQAF
LHHDNKKDVAESQRLGAEAIRGPETWATETKGLRDTGKEFRMSLEDLLALQAPRRGDLGL
GDPRRQLHQGLQAFPL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgggcccccgaaccctcgcattgttgctgtcgggggccctggcagtggccgagatctgg
gcgggctcccactacctgaggtatttctccaccgcggtgtcccggcccggccgcggggag
ccccggtactgggaagtcggctacgtggacgactcgcagttcgcgcggttcgacagcgac
tctgccagtcggaggatggagccgcgggcgccgtgggtggagcaggaggggccggagtat
tgggaccaggagacgcggagggtcaagcacaacgcgcaggctttccaagtgagcctgaac
accctgcggggctactacaaccagagcgaggccgggtctcacaccttccagtggacttat
gcctgcgacgtgggggcccacgggcgtctcctccgcgggtaccagcagtgggcgtacgac
ggcgcggattacatcgccctgaacgaggacctgcgttcctggaccgcggcagacaccgcg
gcgcagatcaccctccgcaagtgggaggtggccggtgaggcagagcgctacaggaactac
ctggaggtcacgtgcgtggagtggcttcggaggcacctggagaacgggaaggagacgctg
ctgcgctcaaaaccccccaacacacacgtgacccaccaccccatctctgaccgtgatgtc
atcctgaggtgctgggccctgggcttctaccctgtggagatcactctgacctggcagcgt
gagggagaggacctgacccaggacacagagcttgtggagaccaggcctgcaggagatggg
accttccagaagtgggctgctgtggtggtgccttctagagaggagcagagatacacatgc
catgtgcagcatgagggactgtctgagcccattaccttgagatgggagcctcctcttccc
atcgtcctcatcacatggatcattgctggtcttgtggtcgctgtggtgattggagctgtg
atctggaggaagaagtgctcaggatcccacggtctttgttataacctcacagtggtgtcc
caggatgaatctgtgcatcggagaatttttgctgaaagacacttggatggtcaggccttc
ctgcaccatgacaacaagaaagatgtggcagagtcacagagattaggggccgaagcaatc
cggggacctgagacatgggcaacagagaccaagggcttgagagacaccgggaaggaattc
agaatgagtctggaagacctcctggccctgcaggcaccaagaagaggagatctgggactg
ggagatccaagaagacaactgcaccagggtcttcaggcatttccactgtga

DBGET integrated database retrieval system