KEGG   Enhydra lutris kenyoni (northern sea otter): 111140276
Entry
111140276         CDS       T05871                                 

Definition
(RefSeq) NF-kappa-B inhibitor alpha isoform X1
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04210  Apoptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04926  Relaxin signaling pathway
elk04931  Insulin resistance
elk05132  Salmonella infection
elk05134  Legionellosis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111140276
   04668 TNF signaling pathway
    111140276
   04024 cAMP signaling pathway
    111140276
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111140276
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140276
   04621 NOD-like receptor signaling pathway
    111140276
   04622 RIG-I-like receptor signaling pathway
    111140276
   04623 Cytosolic DNA-sensing pathway
    111140276
   04625 C-type lectin receptor signaling pathway
    111140276
   04660 T cell receptor signaling pathway
    111140276
   04658 Th1 and Th2 cell differentiation
    111140276
   04659 Th17 cell differentiation
    111140276
   04657 IL-17 signaling pathway
    111140276
   04662 B cell receptor signaling pathway
    111140276
   04062 Chemokine signaling pathway
    111140276
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111140276
   04926 Relaxin signaling pathway
    111140276
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111140276
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111140276
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140276
   05203 Viral carcinogenesis
    111140276
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111140276
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111140276
   05215 Prostate cancer
    111140276
   05222 Small cell lung cancer
    111140276
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111140276
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111140276
   05135 Yersinia infection
    111140276
   05134 Legionellosis
    111140276
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111140276
   05170 Human immunodeficiency virus 1 infection
    111140276
   05161 Hepatitis B
    111140276
   05160 Hepatitis C
    111140276
   05171 Coronavirus disease - COVID-19
    111140276
   05164 Influenza A
    111140276
   05162 Measles
    111140276
   05168 Herpes simplex virus 1 infection
    111140276
   05163 Human cytomegalovirus infection
    111140276
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140276
   05169 Epstein-Barr virus infection
    111140276
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111140276
   05140 Leishmaniasis
    111140276
   05142 Chagas disease
    111140276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111140276
   04131 Membrane trafficking [BR:elk04131]
    111140276
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    111140276
Membrane trafficking [BR:elk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111140276
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 111140276
NCBI-ProteinID: XP_022348288
UniProt: A0A2Y9II30
LinkDB
Position
Unknown
AA seq 358 aa
MFQPAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPEFRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSILQATN
YNGHTCLHLASIRGYLGIVELLVSLGADVNAQVSTSCLQMECLRAARPSTVRPHVLLLQA
EIPNSAINLSNSFGFQEPCNGRTALHLAVDLQNSDLVSLLLKCGADVNRVTYQGYSPYQL
TWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVLGGQRLTL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtttcagcccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc
aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagttggtgaaggaattgaaggagatccgcctcgagccgcaggaggcgccg
cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac
ctggcctttctcaacttccagaacaacctgcagcagactccactccacttggccgtgatc
accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagttccga
gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg
ggagtcctgactcagacctgcaggacccagcacctctcctccatcctccaggccactaac
tacaatgggcacacgtgtctacatttagcctctatccgtggctacttgggcattgtggaa
cttctggtgtctctgggtgctgacgtcaatgctcaggtgagtacttcatgtctccagatg
gagtgcctcagggctgcaaggccctccacagtaagacctcacgtgctcttgttgcaagca
gagattccaaactcagccataaacctctccaattcctttgggtttcaggagccctgcaat
ggccgaaccgccctccatctcgccgtggacctgcagaattctgatctcgtgtcactcttg
ttgaagtgtggggctgatgtcaacagagttacctaccagggctactccccataccagctc
acctggggccgcccaagcacgcggatacagcagcagctgggccagctgaccctagaaaac
cttcagatgttgccagagagcgaggatgaggagagctacgacacggagtcagagttcacg
gaggacgagctgccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system