KEGG   Enhydra lutris kenyoni (northern sea otter): 111140329
Entry
111140329         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140329
   04151 PI3K-Akt signaling pathway
    111140329
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140329
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140329
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140329
   04621 NOD-like receptor signaling pathway
    111140329
   04622 RIG-I-like receptor signaling pathway
    111140329
   04623 Cytosolic DNA-sensing pathway
    111140329
   04650 Natural killer cell mediated cytotoxicity
    111140329
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140329
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140329
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140329
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140329
   05161 Hepatitis B
    111140329
   05160 Hepatitis C
    111140329
   05171 Coronavirus disease - COVID-19
    111140329
   05164 Influenza A
    111140329
   05162 Measles
    111140329
   05168 Herpes simplex virus 1 infection
    111140329
   05163 Human cytomegalovirus infection
    111140329
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140329
   05169 Epstein-Barr virus infection
    111140329
   05165 Human papillomavirus infection
    111140329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140329
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140329
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111140329
NCBI-ProteinID: XP_022348320
UniProt: A0A2Y9IQN0
LinkDB
Position
Unknown
AA seq 187 aa
MALPCSFLVALVMLSCPSLGSLGCDLPQDHGLLHWRALMLLQQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQTLSVIHVTNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACALQEAGVGEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAETMKPLYASTALH
KRLRSRK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtgatgctcagctgcccctccctcggt
tctctgggatgtgacctgcctcaggaccacggcctgctgcactggagggccttgatgctc
ctgcaacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgacggcaagcagctacagaaggctcaaaccctctctgtcatc
catgtgactaaccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggtcacctggaa
gcctgtgccctgcaggaggcgggggtgggagagatgcccctggtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcgagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagaccatgaaacccttgtatgcatcaacagccttgcat
aagagattgcggagcaggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140335
Entry
111140335         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140335
   04151 PI3K-Akt signaling pathway
    111140335
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140335
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140335
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140335
   04621 NOD-like receptor signaling pathway
    111140335
   04622 RIG-I-like receptor signaling pathway
    111140335
   04623 Cytosolic DNA-sensing pathway
    111140335
   04650 Natural killer cell mediated cytotoxicity
    111140335
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140335
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140335
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140335
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140335
   05161 Hepatitis B
    111140335
   05160 Hepatitis C
    111140335
   05171 Coronavirus disease - COVID-19
    111140335
   05164 Influenza A
    111140335
   05162 Measles
    111140335
   05168 Herpes simplex virus 1 infection
    111140335
   05163 Human cytomegalovirus infection
    111140335
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140335
   05169 Epstein-Barr virus infection
    111140335
   05165 Human papillomavirus infection
    111140335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140335
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140335
SSDB
Motif
Pfam: Interferon PORR
Other DBs
NCBI-GeneID: 111140335
NCBI-ProteinID: XP_022348325
UniProt: A0A2Y9L3M9
LinkDB
Position
Unknown
AA seq 179 aa
MPTPARPTASVGSPMALPCSFLVALVVLSCHFLGSLGCDLPQDHGLLHWRALMLLQRMKR
LSASSCDKYTNDFGFPQEVFDSKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLE
ELCSGLSEQLGHLEACPLQEAGVEEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMV
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccaccccagccaggccaacagcatctgtaggatcccctatggccctgccctgctcc
ttcttggtggccctggtggtgctcagctgccacttcctcggctctctgggatgtgacctg
cctcaggaccatggcctgctgcattggagggccttgatgctcctgcaacgaatgaagaga
ctgtctgctagctcctgtgacaagtacacaaacgactttggcttcccccaggaggtgttt
gacagcaagcagctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaag
accttccacctcttctgcacagaggcctcacctgctccttggaacacgactctcctggag
gaattgtgctcgggactttctgagcagctgggccacctggaagcctgtcccctgcaggaa
gctggggtagaagagatgcccctggtgaatggggactccatcctgaggaactacttccag
agaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140336
Entry
111140336         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140336
   04151 PI3K-Akt signaling pathway
    111140336
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140336
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140336
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140336
   04621 NOD-like receptor signaling pathway
    111140336
   04622 RIG-I-like receptor signaling pathway
    111140336
   04623 Cytosolic DNA-sensing pathway
    111140336
   04650 Natural killer cell mediated cytotoxicity
    111140336
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140336
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140336
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140336
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140336
   05161 Hepatitis B
    111140336
   05160 Hepatitis C
    111140336
   05171 Coronavirus disease - COVID-19
    111140336
   05164 Influenza A
    111140336
   05162 Measles
    111140336
   05168 Herpes simplex virus 1 infection
    111140336
   05163 Human cytomegalovirus infection
    111140336
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140336
   05169 Epstein-Barr virus infection
    111140336
   05165 Human papillomavirus infection
    111140336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140336
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140336
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111140336
NCBI-ProteinID: XP_022348326
UniProt: A0A2Y9IJA3
LinkDB
Position
Unknown
AA seq 228 aa
MHKRRCSEKLEPRVPDMPTSARPTTSVGSPMALPCSFLVLLVVLTCHSLGSLGCDLPQDH
GLVPWRALMLLQRMKRLSASSCDNYTNDFGFPQEAFDGKQLQKAQALSVIHVMNQKTFHL
FCTEASPAPLNTTLLEELCSGLSEQLGRLEACPLQEAGVGETPFVNGDSILRNYFQRISL
YLQEKQYSPCAWEMVRAEIMKPLYASTALHKRLRSRKGHPFQRGNGSL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagctagagccacgggtcccagacatgcccacctca
gcgaggccaacaacatctgtaggttcccccatggccctgccctgctccttcttggtgctc
ctggtggtgctcacttgccactccctcggctctctgggatgtgacctgcctcaggaccac
ggcctggtgccctggagggccttgatgctcctgcaacgaatgaagagactgtctgctagc
tcctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgatggcaagcag
ctgcagaaggctcaagccctctctgtcatccatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctcctttgaacacgacactcctggaggaattgtgctcg
ggactttctgagcagctgggccgcctggaagcctgtcccctgcaggaggcgggggtggga
gagacgcccttcgtgaatggggactccatcttgaggaactacttccagagaatctccctc
tatctgcaagagaagcaatacagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacagccttgcataagagattgcggagcaggaagggacacccc
tttcaacgtggaaatggttctctctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140482
Entry
111140482         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140482
   04151 PI3K-Akt signaling pathway
    111140482
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140482
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140482
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140482
   04621 NOD-like receptor signaling pathway
    111140482
   04622 RIG-I-like receptor signaling pathway
    111140482
   04623 Cytosolic DNA-sensing pathway
    111140482
   04650 Natural killer cell mediated cytotoxicity
    111140482
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140482
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140482
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140482
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140482
   05161 Hepatitis B
    111140482
   05160 Hepatitis C
    111140482
   05171 Coronavirus disease - COVID-19
    111140482
   05164 Influenza A
    111140482
   05162 Measles
    111140482
   05168 Herpes simplex virus 1 infection
    111140482
   05163 Human cytomegalovirus infection
    111140482
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140482
   05169 Epstein-Barr virus infection
    111140482
   05165 Human papillomavirus infection
    111140482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140482
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140482
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111140482
NCBI-ProteinID: XP_022348436
UniProt: A0A2Y9IJL4
LinkDB
Position
Unknown
AA seq 175 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQEHGLLNWRALMLLQQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQALSVIHVTNQKTFHLFCTGTSPAPWNTTLLEELCSGLSEQLGLLE
ACPLQEAGVGETPFVNGDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKPLYA
NT seq 525 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaacatggcctgctgaactggagggccttgatgctc
ctgcaacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgatggcaagcagctgcagaaggctcaagccctctctgtcatc
catgtgactaaccagaagaccttccacctcttctgcacagggacctcacctgctccttgg
aacactaccctcctggaggaattgtgctcgggactttctgagcagctgggcctcctggaa
gcctgtcccctgcaggaggcgggggtgggagagacgcccttcgtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgca

KEGG   Enhydra lutris kenyoni (northern sea otter): 111140592
Entry
111140592         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140592
   04151 PI3K-Akt signaling pathway
    111140592
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140592
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140592
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111140592
   04621 NOD-like receptor signaling pathway
    111140592
   04622 RIG-I-like receptor signaling pathway
    111140592
   04623 Cytosolic DNA-sensing pathway
    111140592
   04650 Natural killer cell mediated cytotoxicity
    111140592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140592
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111140592
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111140592
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111140592
   05161 Hepatitis B
    111140592
   05160 Hepatitis C
    111140592
   05171 Coronavirus disease - COVID-19
    111140592
   05164 Influenza A
    111140592
   05162 Measles
    111140592
   05168 Herpes simplex virus 1 infection
    111140592
   05163 Human cytomegalovirus infection
    111140592
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140592
   05169 Epstein-Barr virus infection
    111140592
   05165 Human papillomavirus infection
    111140592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140592
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111140592
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111140592
NCBI-ProteinID: XP_022348506
UniProt: A0A2Y9IJS4
LinkDB
Position
Unknown
AA seq 182 aa
MALPSFFLVALVVLSCHSLGSLGCELPQDYGLMHWRALMLLRHMRTMSASSCDKYTNDFG
FPQQVFDGKGLQKAQALPVVHVMNQKTHHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACPLQETPLLNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALHKRLRS
RK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggccctgcccagcttcttcttggtggccctggtggtgctcagctgtcactcccttggt
tctctgggatgtgaactgcctcaggactacggcctgatgcactggagggccttgatgctc
ctgcgacacatgaggacaatgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccagcaggtgtttgacggcaaggggctgcagaaggctcaagccctccctgtcgtc
catgtgatgaaccagaagacccaccacctcttctgcacagaggcctcacctgctccctgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggagacacccctgctgaatggggactccatcctgaggaactacttc
cagagaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtc
cgagcagagatcatgaaacccttgtatgcatcaacagccttgcataagagattgcggagc
aggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156578
Entry
111156578         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156578
   04151 PI3K-Akt signaling pathway
    111156578
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156578
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156578
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156578
   04621 NOD-like receptor signaling pathway
    111156578
   04622 RIG-I-like receptor signaling pathway
    111156578
   04623 Cytosolic DNA-sensing pathway
    111156578
   04650 Natural killer cell mediated cytotoxicity
    111156578
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156578
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156578
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156578
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156578
   05161 Hepatitis B
    111156578
   05160 Hepatitis C
    111156578
   05171 Coronavirus disease - COVID-19
    111156578
   05164 Influenza A
    111156578
   05162 Measles
    111156578
   05168 Herpes simplex virus 1 infection
    111156578
   05163 Human cytomegalovirus infection
    111156578
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156578
   05169 Epstein-Barr virus infection
    111156578
   05165 Human papillomavirus infection
    111156578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156578
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156578
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111156578
NCBI-ProteinID: XP_022373273
UniProt: A0A2Y9KJK1
LinkDB
Position
Unknown
AA seq 185 aa
MALSISVLLALVMLGSSPARSLDCVLHPSHGNLETFPLLSQMERISILSCLKDRTDFSFP
QMLVDGSKFEKTEATAVTHEMLRQIFSLFSQRGSLVAWDETLLDKFLAGLHQQLDDLETC
LEEEKNVEQLPQGSENSRLAVKRYFRGISLYLEKKEYSRCAWEVVRMEIRRCLFFVSELT
RKLRK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctctccatctctgtgctgctggccctggtgatgctgggctccagcccagcccgc
tctctggactgtgtcctgcatccaagccatggcaatctggaaaccttcccactgttgagt
cagatggagagaatctccattctgtcctgtctgaaggataggactgacttcagctttcct
cagatgcttgtggatgggagcaagtttgagaagacagaagccacagctgtcacgcatgag
atgctccggcagatcttcagccttttcagccaaaggggctccctggtggcttgggacgag
accctactggacaaattcctcgctggacttcatcagcagctggatgacctggagacatgt
ttggaggaagaaaagaacgtggaacagttaccccagggaagtgagaactccagactggct
gtgaagagatacttccgtggaatcagtctctatcttgaaaagaaagaatacagccgctgt
gcctgggaggttgtccggatggaaatcagaaggtgcttgttcttcgtcagtgagctcaca
aggaaactcaggaaataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156593
Entry
111156593         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156593
   04151 PI3K-Akt signaling pathway
    111156593
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156593
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156593
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156593
   04621 NOD-like receptor signaling pathway
    111156593
   04622 RIG-I-like receptor signaling pathway
    111156593
   04623 Cytosolic DNA-sensing pathway
    111156593
   04650 Natural killer cell mediated cytotoxicity
    111156593
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156593
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156593
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156593
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156593
   05161 Hepatitis B
    111156593
   05160 Hepatitis C
    111156593
   05171 Coronavirus disease - COVID-19
    111156593
   05164 Influenza A
    111156593
   05162 Measles
    111156593
   05168 Herpes simplex virus 1 infection
    111156593
   05163 Human cytomegalovirus infection
    111156593
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156593
   05169 Epstein-Barr virus infection
    111156593
   05165 Human papillomavirus infection
    111156593
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156593
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156593
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156593
NCBI-ProteinID: XP_022373286
UniProt: A0A2Y9KI83
LinkDB
Position
Unknown
AA seq 198 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLLNWRALMLLRQMRRVSPFSCLRDRNDFA
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGHLE
ACPLQEAGVGEMPLVNGDSILRNYFQRISLYLQEKQYSPCAWETVRAEIMKAFSSSTTLQ
ERLRGKKRDLVQHGDDSH
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaccatggtctgctgaactggagggccttgatgctc
ctgcgacaaatgaggagagtctcccctttttcctgcctgagggacagaaatgactttgcc
ttcccccaagaggtgtttgacggcaagcagctacagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccctgg
aacacgaccctcctggaggaattgtgctcaggactttctgagcagctgggccacctggaa
gcctgtccccttcaggaggcgggggtgggagagatgcccctggtgaatggggactccatc
ctgaggaactacttccaaagaatctccctctatctgcaagagaagcaatacagcccttgt
gcctgggagacggtcagagcagagatcatgaaagctttctcttcatcaacaaccttgcaa
gaaaggttaaggggcaagaaacgagacctggttcaacatggtgatgactctcactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156594
Entry
111156594         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156594
   04151 PI3K-Akt signaling pathway
    111156594
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156594
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156594
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156594
   04621 NOD-like receptor signaling pathway
    111156594
   04622 RIG-I-like receptor signaling pathway
    111156594
   04623 Cytosolic DNA-sensing pathway
    111156594
   04650 Natural killer cell mediated cytotoxicity
    111156594
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156594
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156594
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156594
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156594
   05161 Hepatitis B
    111156594
   05160 Hepatitis C
    111156594
   05171 Coronavirus disease - COVID-19
    111156594
   05164 Influenza A
    111156594
   05162 Measles
    111156594
   05168 Herpes simplex virus 1 infection
    111156594
   05163 Human cytomegalovirus infection
    111156594
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156594
   05169 Epstein-Barr virus infection
    111156594
   05165 Human papillomavirus infection
    111156594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156594
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156594
SSDB
Motif
Pfam: Interferon ubiquitin PORR
Other DBs
NCBI-GeneID: 111156594
NCBI-ProteinID: XP_022373287
UniProt: A0A2Y9KHI3
LinkDB
Position
Unknown
AA seq 159 aa
MALPCSFLVALVMLSCPSLGSLGCDLSQDHGLLHWRALMLLRQMRTLSASSCDKYTNDFG
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEDSPAPWNTTLLEELCSGLSEQLGHLE
ACPLQEAGVGETPLVNGDSILRNYFQRMPLWLRNLYMFY
NT seq 477 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtgatgctcagctgcccctccctcggc
tctctgggatgtgacctgtctcaggaccacggcctgctgcactggagggccttgatgctc
ctgcgacaaatgaggacactgtctgctagctcctgtgacaagtacacaaacgactttggc
ttcccccaggaggtgtttgatggtaagcagctgcagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggactcacctgctccgtgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggaggcgggggtgggagagacacccctggtgaatggggactccatc
ttgaggaactacttccagagaatgcctttgtggttaagaaatttgtatatgttttac

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156604
Entry
111156604         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156604
   04151 PI3K-Akt signaling pathway
    111156604
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156604
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156604
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156604
   04621 NOD-like receptor signaling pathway
    111156604
   04622 RIG-I-like receptor signaling pathway
    111156604
   04623 Cytosolic DNA-sensing pathway
    111156604
   04650 Natural killer cell mediated cytotoxicity
    111156604
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156604
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156604
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156604
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156604
   05161 Hepatitis B
    111156604
   05160 Hepatitis C
    111156604
   05171 Coronavirus disease - COVID-19
    111156604
   05164 Influenza A
    111156604
   05162 Measles
    111156604
   05168 Herpes simplex virus 1 infection
    111156604
   05163 Human cytomegalovirus infection
    111156604
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156604
   05169 Epstein-Barr virus infection
    111156604
   05165 Human papillomavirus infection
    111156604
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156604
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156604
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156604
NCBI-ProteinID: XP_022373302
UniProt: A0A2Y9KHJ9
LinkDB
Position
Unknown
AA seq 182 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLLHWRALMLLQQMRRVSPFSCLRDRNDFA
FPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEAPPASWNTTLLEELCSGLSEQLGHLE
ACPLQETPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALHKRLKS
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggccctgccctgctccttcttggtggccctggtggtgctcagctgccactccctcggc
tctctgggatgtgacctgcctcaggaccatggcctgctgcactggagggccttgatgctc
ctgcaacaaatgaggagagtctcccctttttcctgcctgagggacagaaatgactttgcc
ttcccccaagaggtgtttgacggcaagcagctacagaaggctcaagccctctctgtcgtc
catgtgacgaaccagaagaccttccacctcttctgcacagaggccccacctgcttcctgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa
gcctgtcccctgcaggagacacccctggtgaatggggactccatcctgaggaactacttc
cagagaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtc
cgagcagagatcatgaaacccttgtatgcatcaacagccttgcataagagattaaagagc
aagaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156606
Entry
111156606         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156606
   04151 PI3K-Akt signaling pathway
    111156606
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156606
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156606
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156606
   04621 NOD-like receptor signaling pathway
    111156606
   04622 RIG-I-like receptor signaling pathway
    111156606
   04623 Cytosolic DNA-sensing pathway
    111156606
   04650 Natural killer cell mediated cytotoxicity
    111156606
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156606
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156606
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156606
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156606
   05161 Hepatitis B
    111156606
   05160 Hepatitis C
    111156606
   05171 Coronavirus disease - COVID-19
    111156606
   05164 Influenza A
    111156606
   05162 Measles
    111156606
   05168 Herpes simplex virus 1 infection
    111156606
   05163 Human cytomegalovirus infection
    111156606
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156606
   05169 Epstein-Barr virus infection
    111156606
   05165 Human papillomavirus infection
    111156606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156606
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156606
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111156606
NCBI-ProteinID: XP_022373304
UniProt: A0A2Y9KPP3
LinkDB
Position
Unknown
AA seq 142 aa
MHKRRCSEKIEPRVPDVPTPARTTASAGSLLQQMRRLPASPCDNYTNDFGFPQEAFDGKQ
LQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLEELCSGIYQRVNDLEACLMQEAGVG
ETPLVNGDSILRNYFQRIYLYL
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagatagagccacgggtcccagacgtgcccacccca
gccaggacaacagcatctgctggatccctcctgcaacaaatgaggagactgcctgctagc
ccctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgacggcaagcag
ctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctccctggaacacgaccctcctggaggaattgtgctca
ggaatttatcagcgggtgaacgacctagaagcctgtctcatgcaggaggcgggggtggga
gagacgcctctcgtgaatggggactccatcctgaggaactacttccagagaatctacctc
tatctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156609
Entry
111156609         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156609
   04151 PI3K-Akt signaling pathway
    111156609
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111156609
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111156609
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111156609
   04621 NOD-like receptor signaling pathway
    111156609
   04622 RIG-I-like receptor signaling pathway
    111156609
   04623 Cytosolic DNA-sensing pathway
    111156609
   04650 Natural killer cell mediated cytotoxicity
    111156609
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156609
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111156609
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156609
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156609
   05161 Hepatitis B
    111156609
   05160 Hepatitis C
    111156609
   05171 Coronavirus disease - COVID-19
    111156609
   05164 Influenza A
    111156609
   05162 Measles
    111156609
   05168 Herpes simplex virus 1 infection
    111156609
   05163 Human cytomegalovirus infection
    111156609
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156609
   05169 Epstein-Barr virus infection
    111156609
   05165 Human papillomavirus infection
    111156609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156609
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111156609
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111156609
NCBI-ProteinID: XP_022373309
UniProt: A0A2Y9KPP8
LinkDB
Position
Unknown
AA seq 217 aa
MHKRRCSENLEPRVPDMPTPARPTASAGSPMALLCSFLVALVVLSCHSLGSLGCDLPQDH
SLLNWRALMLLRQMRRISLISCDKYTNDFAFSKKVFDSKQLQKAQALSVIYVMNQKTFHL
FCTEASPAPWNTTLLEELCSGIYQRVNDLEACLMQEAGVGEMPLVNGDSILRNYFQRIYL
YLRKKQYSPCAWEMVRAEIMKPLYASTILQERLRSKQ
NT seq 654 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaatctagagccacgggtcccagacatgcccacccca
gccaggccaacagcatctgcaggatctcccatggccctgctgtgctccttcttggtggcc
ctggtggtgctcagctgccactccctcggctctctgggatgtgacctgcctcaggaccac
agcctgctgaactggagggccttgatgctcttgagacaaatgaggagaatctcccttatc
tcttgtgacaagtacacaaatgactttgctttctccaagaaggtatttgacagcaagcag
ctgcagaaggctcaagccctctctgtcatctatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctccctggaacacgaccctcctggaggaattgtgctca
ggaatttatcagcgggtgaacgacctagaagcctgtctcatgcaggaggcgggggtggga
gagatgcccctcgtgaatggggactccatcctgaggaactacttccagagaatctacctc
tatctgcgaaagaagcaatatagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacgatcttgcaagaaagattaaggagcaagcaatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159856
Entry
111159856         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159856
   04151 PI3K-Akt signaling pathway
    111159856
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159856
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159856
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159856
   04621 NOD-like receptor signaling pathway
    111159856
   04622 RIG-I-like receptor signaling pathway
    111159856
   04623 Cytosolic DNA-sensing pathway
    111159856
   04650 Natural killer cell mediated cytotoxicity
    111159856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159856
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159856
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159856
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159856
   05161 Hepatitis B
    111159856
   05160 Hepatitis C
    111159856
   05171 Coronavirus disease - COVID-19
    111159856
   05164 Influenza A
    111159856
   05162 Measles
    111159856
   05168 Herpes simplex virus 1 infection
    111159856
   05163 Human cytomegalovirus infection
    111159856
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159856
   05169 Epstein-Barr virus infection
    111159856
   05165 Human papillomavirus infection
    111159856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159856
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159856
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159856
NCBI-ProteinID: XP_022378214
UniProt: A0A2Y9L3M4
LinkDB
Position
Unknown
AA seq 187 aa
MALPCSFLVALVVLSCHSLGSLGCDLPQDHGLMHWRALMILRQMRRLSASSCDNYTNDFG
FPQEVFGGKQLQKAQALSFIHVTSQKTFHLFCTEASPAPWNTTFLEELCSGLSEQLGHLE
ACPLQEAGVGETPLVNGDSILRNYFQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALQ
ERLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgccctgctcctttttggtggccctggtggtgctcagctgccactccctcggt
tctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggcgttgatgatc
ctgcgacaaatgaggagactgtctgctagctcctgtgacaactacacaaatgactttggc
ttcccccaggaggtgttcggtggcaagcagctgcagaaggctcaagccctctctttcatc
catgtgacgagccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccttcctggaggaattgtgctcaggactttctgagcagctgggacacctggaa
gcctgtcccctgcaggaggcgggggtgggagagacacccctggtgaatggggactccatc
ctgaggaactacttccagagaatctccctctatctgcgagagaaacaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaacagccttgcaa
gaaagactaaggagaaagaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159858
Entry
111159858         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159858
   04151 PI3K-Akt signaling pathway
    111159858
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159858
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159858
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159858
   04621 NOD-like receptor signaling pathway
    111159858
   04622 RIG-I-like receptor signaling pathway
    111159858
   04623 Cytosolic DNA-sensing pathway
    111159858
   04650 Natural killer cell mediated cytotoxicity
    111159858
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159858
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159858
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159858
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159858
   05161 Hepatitis B
    111159858
   05160 Hepatitis C
    111159858
   05171 Coronavirus disease - COVID-19
    111159858
   05164 Influenza A
    111159858
   05162 Measles
    111159858
   05168 Herpes simplex virus 1 infection
    111159858
   05163 Human cytomegalovirus infection
    111159858
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159858
   05169 Epstein-Barr virus infection
    111159858
   05165 Human papillomavirus infection
    111159858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159858
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159858
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159858
NCBI-ProteinID: XP_022378217
UniProt: A0A2Y9KW00
LinkDB
Position
Unknown
AA seq 187 aa
MALSCSFLVAPVVLTCHSLGSLGCDLPQDHGLMHWRALMLLRHMRRLSASSCDKYTNDFG
FPQEVFGGKQLQKAQALSVIHVMNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLGRLE
ACPLQEAGVGETALMNGDSILRNYYQRISLYLREKQYSPCAWEMVRAEIMKPLYASTALH
KRLRSGK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgtcctgctccttcttggtggccccggtggtgctcacctgccactcccttggc
tctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggccttgatgctc
ctgcgacacatgaggagactgtctgctagctcctgtgacaagtacacaaatgactttggc
ttcccccaggaggtgtttggtggcaagcagctgcagaaggctcaagctctctctgtcatc
catgtgatgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccttgg
aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccgcctggaa
gcctgtcccctgcaggaggcgggggtgggagagacagcactcatgaatggggactccatc
ttgaggaactactaccagagaatctccctctatctgcgagagaagcaatacagcccttgt
gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaacagccttgcat
aagagactaaggagtgggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159859
Entry
111159859         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159859
   04151 PI3K-Akt signaling pathway
    111159859
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159859
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159859
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159859
   04621 NOD-like receptor signaling pathway
    111159859
   04622 RIG-I-like receptor signaling pathway
    111159859
   04623 Cytosolic DNA-sensing pathway
    111159859
   04650 Natural killer cell mediated cytotoxicity
    111159859
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159859
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159859
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159859
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159859
   05161 Hepatitis B
    111159859
   05160 Hepatitis C
    111159859
   05171 Coronavirus disease - COVID-19
    111159859
   05164 Influenza A
    111159859
   05162 Measles
    111159859
   05168 Herpes simplex virus 1 infection
    111159859
   05163 Human cytomegalovirus infection
    111159859
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159859
   05169 Epstein-Barr virus infection
    111159859
   05165 Human papillomavirus infection
    111159859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159859
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159859
SSDB
Motif
Pfam: Interferon ubiquitin
Other DBs
NCBI-GeneID: 111159859
NCBI-ProteinID: XP_022378218
UniProt: A0A2Y9KYQ0
LinkDB
Position
Unknown
AA seq 209 aa
MFREPRATGPRRAHPTPSVGSPMALPCSFLVALVVLSCHSLGSLGCDLPQDHGLMHWRAL
MLLQQMKRLSASSCDKYTNDFGFPQEVFDGKQLQKAQALSVVHVTNQKTFHLFCTEASPA
PWNTTLLGELCSGLSEQLGLLEACPLQEAGVGEMPLMNGDSILRNYFQRISLYLQEKQYS
PCAWEMVRAETMKPLYASMALHKRLQSRK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttcagagaacctagagccacgggtcccagacgtgcccaccccaccccatctgtagga
tcccccatggccctgccctgctccttcttggtggccctggtggtgctcagctgccactcc
cttggctctctgggatgtgacctgcctcaggaccacggcctgatgcactggagggccttg
atgctcctgcaacaaatgaagagactgtctgctagctcctgtgacaagtacacaaatgac
tttggcttcccccaggaggtgtttgatggcaagcagctgcagaaggctcaagccctctct
gtcgtccatgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgct
ccttggaacacgaccctcctgggggaattgtgctcgggactttctgagcagctgggcctc
ctggaagcctgtcccctgcaggaggcgggagtaggagagatgcccctcatgaatggggac
tccatcctgaggaactacttccagagaatctccctctatctacaagagaagcaatacagc
ccttgtgcctgggagatggtccgagcagagaccatgaaacccttgtatgcatcaatggcc
ttgcataagagattgcagagcaggaagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159861
Entry
111159861         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159861
   04151 PI3K-Akt signaling pathway
    111159861
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159861
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159861
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159861
   04621 NOD-like receptor signaling pathway
    111159861
   04622 RIG-I-like receptor signaling pathway
    111159861
   04623 Cytosolic DNA-sensing pathway
    111159861
   04650 Natural killer cell mediated cytotoxicity
    111159861
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159861
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159861
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159861
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159861
   05161 Hepatitis B
    111159861
   05160 Hepatitis C
    111159861
   05171 Coronavirus disease - COVID-19
    111159861
   05164 Influenza A
    111159861
   05162 Measles
    111159861
   05168 Herpes simplex virus 1 infection
    111159861
   05163 Human cytomegalovirus infection
    111159861
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159861
   05169 Epstein-Barr virus infection
    111159861
   05165 Human papillomavirus infection
    111159861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159861
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159861
SSDB
Motif
Pfam: Interferon PORR
Other DBs
NCBI-GeneID: 111159861
NCBI-ProteinID: XP_022378219
UniProt: A0A2Y9L3M9
LinkDB
Position
Unknown
AA seq 179 aa
MPTPARPTASVGSPMALPCSFLVALVVLSCHFLGSLGCDLPQDHGLLHWRALMLLQRMKR
LSASSCDKYTNDFGFPQEVFDSKQLQKAQALSVVHVTNQKTFHLFCTEASPAPWNTTLLE
ELCSGLSEQLGHLEACPLQEAGVEEMPLVNGDSILRNYFQRISLYLREKQYSPCAWEMV
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccaccccagccaggccaacagcatctgtaggatcccctatggccctgccctgctcc
ttcttggtggccctggtggtgctcagctgccacttcctcggctctctgggatgtgacctg
cctcaggaccatggcctgctgcattggagggccttgatgctcctgcaacgaatgaagaga
ctgtctgctagctcctgtgacaagtacacaaacgactttggcttcccccaggaggtgttt
gacagcaagcagctgcagaaggctcaagccctctctgtcgtccatgtgacgaaccagaag
accttccacctcttctgcacagaggcctcacctgctccttggaacacgactctcctggag
gaattgtgctcgggactttctgagcagctgggccacctggaagcctgtcccctgcaggaa
gctggggtagaagagatgcccctggtgaatggggactccatcctgaggaactacttccag
agaatctccctctatctgcgagagaagcaatacagcccttgtgcctgggagatggtctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159862
Entry
111159862         CDS       T05871                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159862
   04151 PI3K-Akt signaling pathway
    111159862
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159862
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111159862
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111159862
   04621 NOD-like receptor signaling pathway
    111159862
   04622 RIG-I-like receptor signaling pathway
    111159862
   04623 Cytosolic DNA-sensing pathway
    111159862
   04650 Natural killer cell mediated cytotoxicity
    111159862
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159862
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111159862
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159862
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159862
   05161 Hepatitis B
    111159862
   05160 Hepatitis C
    111159862
   05171 Coronavirus disease - COVID-19
    111159862
   05164 Influenza A
    111159862
   05162 Measles
    111159862
   05168 Herpes simplex virus 1 infection
    111159862
   05163 Human cytomegalovirus infection
    111159862
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159862
   05169 Epstein-Barr virus infection
    111159862
   05165 Human papillomavirus infection
    111159862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111159862
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interferons
   111159862
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111159862
NCBI-ProteinID: XP_022378220
UniProt: A0A2Y9IJA3
LinkDB
Position
Unknown
AA seq 228 aa
MHKRRCSEKLEPRVPDMPTSARPTTSVGSPMALPCSFLVLLVVLTCHSLGSLGCDLPQDH
GLVPWRALMLLQRMKRLSASSCDNYTNDFGFPQEAFDGKQLQKAQALSVIHVMNQKTFHL
FCTEASPAPLNTTLLEELCSGLSEQLGRLEACPLQEAGVGETPFVNGDSILRNYFQRISL
YLQEKQYSPCAWEMVRAEIMKPLYASTALHKRLRSRKGHPFQRGNGSL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcacaagagaagatgttcagagaagctagagccacgggtcccagacatgcccacctca
gcgaggccaacaacatctgtaggttcccccatggccctgccctgctccttcttggtgctc
ctggtggtgctcacttgccactccctcggctctctgggatgtgacctgcctcaggaccac
ggcctggtgccctggagggccttgatgctcctgcaacgaatgaagagactgtctgctagc
tcctgtgacaactacacaaacgactttggcttcccccaggaggcgtttgatggcaagcag
ctgcagaaggctcaagccctctctgtcatccatgtgatgaaccagaagaccttccacctc
ttctgcacagaggcctcacctgctcctttgaacacgacactcctggaggaattgtgctcg
ggactttctgagcagctgggccgcctggaagcctgtcccctgcaggaggcgggggtggga
gagacgcccttcgtgaatggggactccatcttgaggaactacttccagagaatctccctc
tatctgcaagagaagcaatacagcccttgtgcctgggagatggtccgagcagagatcatg
aaacccttgtatgcatcaacagccttgcataagagattgcggagcaggaagggacacccc
tttcaacgtggaaatggttctctctga

DBGET integrated database retrieval system