KEGG   Enhydra lutris kenyoni (northern sea otter): 111140516
Entry
111140516         CDS       T05871                                 

Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04612  Antigen processing and presentation
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111140516
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111140516
   05170 Human immunodeficiency virus 1 infection
    111140516
   05168 Herpes simplex virus 1 infection
    111140516
   05163 Human cytomegalovirus infection
    111140516
   05169 Epstein-Barr virus infection
    111140516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111140516
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111140516
SSDB
Motif
Pfam: C1-set Ig_3 I-set C2-set_2
Other DBs
NCBI-GeneID: 111140516
NCBI-ProteinID: XP_022348457
UniProt: A0A2Y9IIG6
LinkDB
Position
Unknown
AA seq 118 aa
MAPLLTLVIVGLLSLSGLHAVQHAPKIQVYSRHPAENGKPNFLNCYVSGFHPPEIEIELL
KNGEKMNAEQSDLSFSKDWTFYLLVHTEFTPNGQDEFSCRVKHVTLKDPQVVKWDRDN
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgcctctcttgacgttggtcatcgtcgggctgctctctctgtccggcctgcacgcc
gtccaacatgctccaaaaattcaggtttactcacggcacccggcagagaatggaaagcca
aatttcctgaactgctatgtgtcaggattccacccaccagaaattgaaatcgaactgctg
aagaatggggagaaaatgaatgcagaacagtcagacctgtctttcagcaaggactggact
ttctatcttctggtccacactgaattcactcccaatggacaggatgagtttagctgccgt
gtgaagcatgttactctcaaagatccccaggtcgttaaatgggaccgagacaactaa

DBGET integrated database retrieval system