KEGG   Enhydra lutris kenyoni (northern sea otter): 111140634
Entry
111140634         CDS       T05871                                 

Definition
(RefSeq) TATA box-binding protein-like protein 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03022  Basal transcription factors
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    111140634
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111140634
  09164 Neurodegenerative disease
   05016 Huntington disease
    111140634
   05017 Spinocerebellar ataxia
    111140634
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111140634
   05165 Human papillomavirus infection
    111140634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111140634
   03021 Transcription machinery [BR:elk03021]
    111140634
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    111140634
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     111140634
  RNA polymerase III system
    TFIIIB
     111140634
  RNA polymerase I system
    SL1/TIF-1B
     111140634
SSDB
Motif
Pfam: TBP DUF3378 Auxin_repressed
Other DBs
NCBI-GeneID: 111140634
NCBI-ProteinID: XP_022348539
UniProt: A0A2Y9IMG5
LinkDB
Position
Unknown
AA seq 344 aa
MEEEQTYLELYLDECVAQDDLAAPRSPLLSPVTPDVVDIPNSSHPETVFNSHLEEVQETS
GHFSCVDLSFLPDELTQENKDQSVVRSKHEIEENCKTQSQPSRLSLPREQDIGLGLISSS
NVSNSHSHLYPGDADSVQPSLEKPNSMPLVSITPMTPMTPVSECSGIVPQLQNIVSTVNL
ACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAA
RKYARVVQKLGFPARFLDFKVQNMVGSCDVRFAIRLEGLVLTHQQFSSYEPELFPGLIYR
MVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaggaggagcagacgtacctggagctctacctggacgagtgtgtcgcccaggatgac
ctcgctgcacccaggtcgcctctgctcagcccagtcacacctgatgttgtggatatccct
aattcatcccatccagagaccgtgtttaattcacatcttgaagaagtccaagaaacctct
ggccatttctcatgtgtggatcttagcttcctaccagatgaacttacccaagaaaataaa
gaccagagtgtcgttagaagcaagcatgaaattgaagaaaattgtaaaactcaaagtcag
ccaagtaggctgtcattacccagggaacaggacattggtctggggttaataagcagcagc
aatgtatcgaattcccactcacatctgtaccctggtgatgctgattcagtccagccttct
cttgagaaaccaaattccatgcctctggtgtctataacgcccatgacaccaatgacccct
gtttcagaatgttctggaattgtgcctcagctacagaatatagtatccactgtaaacctg
gcctgtaaattggatctgaagaaaatagctttgcacgcaaaaaatgcagagtataaccca
aagaggtttgctgctgtcataatgaggatccgagagcccagaacaaccgccctcatattt
agctccgggaaaatggtctgcaccggagccaaaagtgaagagcagtctcgacttgcagcg
aggaagtatgctcgtgtggtgcaaaagctggggttcccagccagattcctcgattttaaa
gttcagaacatggttggaagctgtgatgtgagattcgccatcaggctggaaggtctggtg
ttaacccatcagcagttcagtagttatgaacctgaattgtttcctggccttatttataga
atggtgaaaccacgaattgtgttgcttatctttgtatctggaaaagttgtgttgacaggt
gccaaagaacgttctgagatctatgaagcatttgaaaacatctatcctattctaaagggt
tttaaaaaagcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147566
Entry
111147566         CDS       T05871                                 

Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03022  Basal transcription factors
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    111147566
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111147566
  09164 Neurodegenerative disease
   05016 Huntington disease
    111147566
   05017 Spinocerebellar ataxia
    111147566
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147566
   05165 Human papillomavirus infection
    111147566
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111147566
   03021 Transcription machinery [BR:elk03021]
    111147566
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    111147566
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     111147566
  RNA polymerase III system
    TFIIIB
     111147566
  RNA polymerase I system
    SL1/TIF-1B
     111147566
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 111147566
NCBI-ProteinID: XP_022359376
UniProt: A0A2Y9JFL0
LinkDB
Position
Unknown
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcattggacattctaattacaaatgtagtctgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttggagggagcaaatgtaatttat
aagcgtgacgttggaaaggtattaatgaagctgagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccaggcgtttagcccgcagtcttcagaaactaggttttcaggtaatatttacagatttt
aaggttgttaacgttttggcagtgtgtaacatgccatttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttatgaacctgaacttcatcctgctgtgtgctat
cggataaaatctctaagagctacattacagattttttcaacaggaagtatcacagtaaca
gggcccaacgtaaaggctgttgcgactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagaaattttataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158703
Entry
111158703         CDS       T05871                                 

Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03022  Basal transcription factors
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    111158703
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111158703
  09164 Neurodegenerative disease
   05016 Huntington disease
    111158703
   05017 Spinocerebellar ataxia
    111158703
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111158703
   05165 Human papillomavirus infection
    111158703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111158703
   03021 Transcription machinery [BR:elk03021]
    111158703
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    111158703
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     111158703
  RNA polymerase III system
    TFIIIB
     111158703
  RNA polymerase I system
    SL1/TIF-1B
     111158703
SSDB
Motif
Pfam: TBP DDHD DUF2722 EPL1 Spt20 UPF0565 SpoIIP Presenilin ABC2_membrane_2 V_ATPase_I TFIIA MMR1 PAT1
Other DBs
NCBI-GeneID: 111158703
NCBI-ProteinID: XP_022376620
UniProt: A0A2Y9KRI3
LinkDB
Position
Unknown
AA seq 330 aa
MDQNSSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSLLEEQQRQQQ
QQQQAQQQQQQQAQQQAQQQAQQQQQQQAVAAVQQSTSQQAAQGASGQTPQLFHSQTLTT
APLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARN
AEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAK
FLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGK
VVLTGAKVRAEIYEAFENIYPILKGFRKTT
NT seq 993 nt   +upstreamnt  +downstreamnt
atggatcagaacagcagcctgccgccttatgctcagggcctggcctcccctcagggtgcc
atgactcctggaatccctatcttcagtccgatgatgccttatggcacaggactgactcca
cagcctatccagaacaccaacagcctttccctcttggaggagcagcagaggcagcagcag
cagcagcagcaggcccagcagcagcagcagcagcaggcccagcagcaggcccagcagcag
gcccagcagcagcagcagcagcaggcagtggccgcggttcagcagtccacctcccagcag
gccgcccagggggcctcgggccagacaccacagctcttccactcacagactcttaccact
gcacccttgccgggcaccactccactgtatccctcccccatgacccccatgacccccatt
acccctgccacaccagcctctgagagctcggggatcgtgccgcagctgcaaaatatcgta
tccaccgtgaatcttggctgtaagcttgacctaaagaccattgcacttcgtgcccgaaat
gctgaatataatcccaagcgatttgctgctgtaatcatgagaataagagagccccgaacc
actgcactgatattcagttctgggaagatggtgtgcacaggagccaagagtgaagaacag
tccagactagcagcgaggaaatatgccagagttgtacagaagttaggttttccagccaag
ttcttggacttcaagattcagaacatggtggggagctgtgatgtgaagttcccgataagg
ctagaaggcctcgtgctgacccaccagcagtttagcagttacgagccagagttatttcct
ggtttaatctacagaatgatcaaacccagaattgttcttcttatttttgtttctggaaaa
gttgtattaacaggtgctaaagtcagagcggaaatttatgaagcatttgaaaatatctac
cctattctaaagggtttcaggaagacgacataa

DBGET integrated database retrieval system