KEGG   Enhydra lutris kenyoni (northern sea otter): 111140665
Entry
111140665         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04910  Insulin signaling pathway
elk04917  Prolactin signaling pathway
elk04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140665
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111140665
   04917 Prolactin signaling pathway
    111140665
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111140665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111140665
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111140665
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 111140665
NCBI-ProteinID: XP_022348579
UniProt: A0A2Y9IMK6
LinkDB
Position
Unknown
AA seq 441 aa
MAENSDSISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKNESCSDAETVNAVEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINPKSNEWVSTDSSQSELRDGQLKQRR
NVEEEVNCFSQTNVQPCVITTNSASSCRGGPMTGSVMNLVSNNSIEDSDMDSDDEIITLC
TSSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEA
LLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDIT
GLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLY
LKEYHYKSKVRVLRIDAPEQC
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcagaaaatagtgacagtattagcaaaaatgtagatgtgaggcccaaaactagtcga
agtagaagtgctgacagaaaggacggttatgtgtggagtggaaagaaattatcttggtca
aaaaagaatgaaagttgttcagatgctgaaacagtgaatgctgtagagaaaactgaagtt
cctttaaggagccaagaaaggaagcacagctgttcatctatcgagttggatttagatcat
tcctgtgggcatagatttttaggccgctctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtggtcggcactcttcggggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcactttattaaacgacacactgctcctataaatcccaaatccaatgaa
tgggtaagcacagactcgtctcagagtgaactgagggatggtcagctaaaacaaagaaga
aacgtggaagaagaggtaaactgcttctcacaaaccaatgttcagccctgtgtcataacc
actaacagtgcttcttcatgtagaggtggtcccatgactggctctgtgatgaacctggtt
tcaaataacagtatagaagatagtgatatggattcggatgacgaaattattacactttgc
acaagttccaggaaaagaaacaaacccaaatgggaaatggatgaagaaatcctgcagttg
gaaacacctcctaagtaccatacccagattgattatgtccactgtcttgtaccagacctc
ctgcagatcaataacaatccatgttactggggagttatggataaatatgcagctgaagct
ctactggagggaaaaccagagggtacctttttacttcgagactcagcacaggaagactat
ttattctcagttagttttagacgctatagtcgttctcttcatgctagaattgaacaatgg
aatcacaactttagctttgatgcacatgatccttgtgtcttccattctcctgacattact
gggctcctagaacattataaggacccaagtgcctgtatgttctttgaaccacttttatcc
actcctttaattcggactttccccttttccttgcagcatatatgcagaacagttatttgt
aactgtacaacttacgatggcattgatgcccttccaattccttcttctatgaaattatat
ctgaaggaatatcactataaatcaaaagttagagtactcaggattgatgcaccagaacaa
tgctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142151
Entry
111142151         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04910  Insulin signaling pathway
elk04917  Prolactin signaling pathway
elk04930  Type II diabetes mellitus
elk04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142151
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111142151
   04917 Prolactin signaling pathway
    111142151
   04935 Growth hormone synthesis, secretion and action
    111142151
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111142151
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111142151
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111142151
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 111142151
NCBI-ProteinID: XP_022350847
UniProt: A0A2Y9IQ38
LinkDB
Position
Unknown
AA seq 281 aa
MSAGEAAWCGGGGRGRGKLWVTAPAGYFAIRPLGPGEEEPQAPNPLLLHHFGYPADTDFQ
EGRLPPLTPSRVATCLCRGDPSPMTLRCLEPSGNGAEGTQSQWGTAGSAEEPSPEAARLA
KALQELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRI
EYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLY
TAVRPLQHLCRLTINKCTGTIWGLPLPTRLKDYLEEYKFQV
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtccgctggggaggctgcctggtgtggaggcggcggccgaggccgaggcaaactctgg
gtgaccgcgcctgcggggtactttgccatccgtccactgggacctggggaggaagaaccc
caagcacccaatcccctcctcctccaccatttcggataccccgcagacactgactttcaa
gaaggacgcttgccccctctgaccccatcgcgggtggccacctgtctttgccgcggtgat
ccctctcccatgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcag
agccagtgggggaccgcgggatccgcggaggagccgtcccccgaggcggcgcgtttggcg
aaggccctacaggagctcagtcaaacaggttggtactggggaagtatgactgttaatgaa
gccaaagagaaattaaaagaggcacccgaaggaactttcttgattagagatagctcgcat
tcagactacctactaacaatatctgttaagacatcagctggaccaaccaatctgcgaatt
gaataccaagatgggaaattcagattggactctatcatatgtgtcaagtccaagcttaaa
caatttgacagtgtggttcatctgattgactactatgttcagatgtgcaaggataagcgg
acgggcccggaagctccccggaacggcaccgtccacctttacctgaccaaaccgctctac
acagccgtgcggccgctccaacatctctgtagactcaccattaacaaatgtaccggtacc
atctggggactgcctttaccaacaagactaaaagattacttggaagagtataaattccag
gtataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151637
Entry
111151637         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X1
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111151637
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111151637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111151637
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111151637
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 111151637
NCBI-ProteinID: XP_022365468
UniProt: A0A2Y9JWV4
LinkDB
Position
Unknown
AA seq 576 aa
MVFRNVGRPPEEEDAEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPMQDLVPPGRLGRGEP
QQPPPPPPPPGPLRPLAGPSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKRPSGELAASA
ASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHP
PTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRTAPIRAA
ESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVR
DSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNG
KFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLI
SYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgcggaggcggccccggag
ccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggaccccaaggccctg
ccgccggggttggcgctcgagcggacctggggcccggcggctggactggaggcgcagttg
gcggctctggggctcgggcagccggcggggccgggggtcaagacggtcggtgggggttgc
tgcccgtgcccgtgccccccgcagccgccccctccgcagccccagccgcctgctgccgcc
ccgcaggccggggaggaccccacggaaacgagcgacgcgcttttggtcctggagggcttg
gagtcggaggccgagagcctggagacgaacagctgctcggaagaggagctcagcagcccg
ggccgcggaggaggagggggcggccggcttctgctgcagcccccgggtcccgaattaccc
ccggttcccttcccgatgcaggacttggtccccccagggcgcttgggtagaggggagccg
cagcaaccgcccccgcctccgccccctcctgggcccctccggccactggctggcccttct
cggaagggctccctcaaaatccgcctcagtcgcctctttcgcacgaagagctgcaacggc
ggctccggcggcggggatggggccggcaagaggccttctggagagctggctgcttctgct
gcgagcctgacagacatgggaggctctgcgggccgggagctggacgcggggaggaaaccc
aggttgacaagaactcaaagtgccttttctccggtctccttcagccccctgttcacaggt
gaaactgtgtcgcttgtggacgtggacatctctcagcggggcctgacctctccacaccct
ccaactccccctcctcctccgagaagaagcctcagcctcctagatgatatcagtgggacg
ctgcctacatctgtccttgtggctccgatggggtcttccctgcagtctttccccctacct
ccgcctcctccaccccatgccccagatgcgtttccccggacggctcccatccgagcagct
gaatccctgcacagccagcccccccagcatctccagtgtcccctctaccggcccgactca
agcagctttgccgccagccttcgagagttggagaagtgtggttggtactggggaccaatg
aactgggaagatgcagagatgaagctgaaagggaagccagatggctctttcctggtacga
gacagctctgaccctcgctacatcctgagcctcagtttccggtcacagggtatcacccac
cacacaagaatggagcactacagaggaactttcagtctgtggtgtcaccccaagtttgag
gatcgttgtcagtcggtggtggaattcatcaagagagccatcatgcactccaagaatggg
aagttcctctatttcctgagatccagggttccaggactaccaccaactccagtccagctg
ctctaccctgtgtctagattcagcaatgtcaaatccctccagcacctttgcagattccga
atccgacagctcgtccggatagatcacatcccggatctcccactgcctaaacctctgatc
tcttatatccgaaagttctactactatgatcctcaggaagaggtgtacctgtctctaaag
gaagcgcagctcatttccaaacagaagcaagaggtcgaaccctccacgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154286
Entry
111154286         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111154286
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111154286
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111154286
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111154286
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111154286
NCBI-ProteinID: XP_022369498
UniProt: A0A2Y9KD71
LinkDB
Position
Unknown
AA seq 535 aa
MKKISLKTFRKSFNLSKSKEETDFMVVQQPALAGDFGKDEPLFGGCYGKELAGCDLSGDD
EKGGKGRSKSESLMGTLKRRLSAKQKQKGKGGAASGGSADEDTFSSSSAPLVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHTSSPSPALNGVRKDFHDLQS
ETVCPEQSSSLKGSESQHGDLHLHLEEHVPVVIGLVPQDYIQYTVPLDEGMYPLEGPRGY
CLDTSSPMEVSAVPPQVGGGSFAEDGNQVDQDLVVAPEIFVDQAVNGLLIGTTGVMLQSP
RAGHDDAPPLSPLLPPMQTNPVQRNFGALAGTDAHVAESVRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaagatcagcctcaagaccttccggaagtcgttcaacctgagcaagagtaaggag
gagacggatttcatggtggtgcagcagccggcgctcgccggcgacttcgggaaggacgag
cccttgttcggcggctgctacgggaaggagctggcgggctgcgacctgagcggcgacgac
gagaagggcgggaagggccgctccaagagcgagagcctcatgggtacgttgaaacggcgg
ctgtcggcgaagcagaagcagaagggcaagggcggcgcggcgtccggcggctcggccgac
gaggacaccttctcctcctcgtcggcgccgctggtcttcaaggacgtgcgcgcgcagcgg
cccatccgctccacgtcgctccgcagccaccactacagccccacgccgtggcccctgcgg
cccaccaactcggaggagacgtgcatcaagatggaggtgagggtcaaggccttggttcac
acgtccagcccgagcccggccctgaacggcgtgcggaaggattttcacgacctgcagtcg
gagaccgtgtgcccggagcagagcagctccctcaagggttccgagtcccagcacggggac
ctgcacctgcacctcgaggaacacgtgcctgtcgttatcggacttgtgcctcaggactac
attcagtacaccgtgcctttagacgaggggatgtacccgctggaggggccgcgcggctac
tgtctggacacctcttcgcccatggaggtctccgcggtccctccgcaggtgggaggcggc
tccttcgccgaagacgggaatcaggtagaccaggacctcgtggtggccccggagatcttc
gtggaccaggcggtgaacggcctgttgatcggcaccaccggagtcatgctgcagagcccc
cgagccggtcacgacgacgcccccccactctcaccgttgctacctccgatgcagaccaat
ccagtccaaaggaacttcggtgcgctcgccggcacagacgcccacgtggccgaaagcgtg
cgctgccatttgaattttgacccgaactccgcccctggggtggcgagagtgtatgactcg
gtgcagagcagcgggcccatggttgtgacgagccttacagaggagctgaaaaaactggcg
aaacaaggatggtactggggacccatcacgcgctgggaggcagaagggaagttggcgaat
gtgccagatggctctttccttgttcgggacagttctgacgaccgttaccttttgagcttg
agcttccgctcccatggcaaaacacttcacacgagaatcgaacactccaatggtaggttt
agcttttatgaacagccggacgtagaaggacatacgtccatcgttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggttgcctggatct
gcaacttacccggtcagactgaccaatcccgtgtcacggttcatgcaggtgcgttctttg
cagtacctgtgtcgttttgttatacgtcagtatactaggatagacttgattcagaaactg
cctttgccaaacaaaatgaaggattacttacaggagaagcactactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155864
Entry
111155864         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155864
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111155864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111155864
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111155864
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 111155864
NCBI-ProteinID: XP_022372009
UniProt: A0A2Y9KKQ8
LinkDB
Position
Unknown
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKERNISTGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGARLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVSGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaagatgtggaataacttcaaatacaggtgtcagaatctcttcggt
cacgagggagggagccgtagtgaaaatgtggacatgaattccaatagatgtttgtctgtg
aaagagagaaacatcagtacaggagactcagctcctcagcaacaaagcagtcccttaaga
gaaaacgttgccttacaactgggattaagcccttccaagaattcttcaaggagaaaccaa
aactgtgccactgaaattcctcagattgttgaaataagcattgaaaaggataatgattcc
tgtgtcaccccaggagcgagacttgcaagaagggattcctactctcggcatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacacagagttcattggatacggataaa
aagttcggtagaactcgaagcggacttcaaaggagagagaggcggtatggtgtaagctcc
gtgcatgacatggacagcgtgtccagcagaactgtggggagccgctctctgagacagagg
ttgcaggacactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaaaccc
ctcttttctaataaaagaaaaatacacctttctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagcccctgtg
agcccacactcgacattttttgatacgtttgatccatccttggtttccacggaagatgaa
gaagataggcttcgagagagaagacggctcagtattgaagagggggttgaccctccgccc
aatgcacaaatacatacctttgaagccaccgcacaggttaatccgttatataaactggga
ccaaagttagctcctggaatgactgaagtaagtggggacagtagtgcaattccacaagct
aactgtgactcagaagaggacactaccaccctgtgtctgcagtcacgtaggcagaagcaa
cgtcaggtgtctggagacagccatgcccatgttagcagacagggagcttggaaagtccat
acgcagatcgattacatacactgcctcgtgccggacttgctccagattacagggaatccc
tgttactggggagtgatggaccgttacgaagcagaagccctccttgaagggaaacctgaa
ggcacattcttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgt
cgctacaacaggtccctgcatgcccgaattgaacagtggaatcacaactttagttttgac
gcccacgacccttgtgtatttcactcctccactgtaacaggacttttggaacattataaa
gatcctagttcttgcatgttttttgaacccttgcttactatatcactaaacaggactttc
ccttttagcctgcagtatatctgccgtgcagtaatctgtagatgcactacatatgatgga
attgatgggcttcctttaccatcaatgttgcaggattttttgaaagagtatcattacaag
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcgaagtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156124
Entry
111156124         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04120  Ubiquitin mediated proteolysis
elk04380  Osteoclast differentiation
elk04630  JAK-STAT signaling pathway
elk04910  Insulin signaling pathway
elk04917  Prolactin signaling pathway
elk04930  Type II diabetes mellitus
elk04935  Growth hormone synthesis, secretion and action
elk05145  Toxoplasmosis
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111156124
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111156124
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111156124
   04917 Prolactin signaling pathway
    111156124
   04935 Growth hormone synthesis, secretion and action
    111156124
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111156124
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111156124
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111156124
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111156124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111156124
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111156124
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111156124
NCBI-ProteinID: XP_022372471
UniProt: A0A2Y9KG18
LinkDB
Position
Unknown
AA seq 222 aa
MVAHNQVAADNAISTAAESRRRPEPSSSSSSSSSPSSAAPAAPARPRPCPAAAAPAPAPA
PGDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQR
NCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQR
RVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 669 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagtcccga
cggcggccagagccttcctcgtcttcgtcttcgtcctcgtccccgtcctcggcggcgccc
gcggcccccgcgcgcccgcggccctgcccggcggccgcggcccccgccccggccccggcc
cccggcgacacgcacttccgcacgttccgctcgcacgcagactaccggcgcatcacccgg
gccagcgcgctgctcgacgcctgcggcttctactgggggcccctgagcgtgcacggggcg
cacgagcggctgcgcgccgagcccgtgggcaccttcctggtgcgcgacagccgccagcgg
aactgcttcttcgctctcagcgtgaagatggcctcgggccccacgagcatccgcgtgcac
ttccaggccggccgcttccacctggacggcagccgcgagagcttcgactgcctcttcgag
ctgctggagcactacgtggcggcgccgcgtcgcatgctcggggccccgctgcgccagcgc
cgcgtgcggccgctgcaggagctgtgtcgccagcgcatcgtggccaccgtgggccgcgag
aacctggcgcgcatccccctcaaccccgtcctgcgcgactatctgagctccttccccttc
cagatctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160348
Entry
111160348         CDS       T05871                                 

Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04120  Ubiquitin mediated proteolysis
elk04380  Osteoclast differentiation
elk04630  JAK-STAT signaling pathway
elk04668  TNF signaling pathway
elk04910  Insulin signaling pathway
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04935  Growth hormone synthesis, secretion and action
elk05160  Hepatitis C
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111160348
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111160348
   04668 TNF signaling pathway
    111160348
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111160348
   04920 Adipocytokine signaling pathway
    111160348
   04917 Prolactin signaling pathway
    111160348
   04935 Growth hormone synthesis, secretion and action
    111160348
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111160348
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111160348
   04932 Non-alcoholic fatty liver disease
    111160348
   04931 Insulin resistance
    111160348
  09172 Infectious disease: viral
   05160 Hepatitis C
    111160348
   05164 Influenza A
    111160348
   05168 Herpes simplex virus 1 infection
    111160348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111160348
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111160348
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111160348
NCBI-ProteinID: XP_022379107
UniProt: A0A2Y9KYE1
LinkDB
Position
Unknown
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPPSQPLPGNPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtccgcaag
ctgcaggagagcggcttctactggagcgccgtgacgggcggcgaggcgaacctgctgctc
agcgccgagcccgccggcacctttctcatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcgctgcagagcgacccccggagcacgcagccggtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgccgccccccggcgccccctccttcccctcgccaccg
accgagccctcctctgaggtgccggagcagccgccatcccagccgctccccgggaatccc
cccaggagagcctattacatctactcggggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactctccagcatctctgtcggaagacggtcaatggccac
ctggactcctatgagaaagtcacccagctgcctgggcccattcgggaattcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system