KEGG   Enhydra lutris kenyoni (northern sea otter): 111140679Help
Entry
111140679         CDS       T05871                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 2 isoform X1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03410  Base excision repair
elk04210  Apoptosis
elk04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    111140679
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111140679
   04217 Necroptosis
    111140679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111140679
   03036 Chromosome and associated proteins [BR:elk03036]
    111140679
   03400 DNA repair and recombination proteins [BR:elk03400]
    111140679
Enzymes [BR:elk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     111140679
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111140679
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    111140679
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     111140679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 111140679
NCBI-ProteinID: XP_022348598
UniProt: A0A2Y9IIZ5
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MAARRRGTRSNGAGALDEAGRVHNGNTAIEDPPPAKKTRRCQRQGVKKEPVNGGEANNNK
TENKQESVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQ
LLEDDAQKHFSVWMRWGRVGKMGQHSLVACSGDLNKAKEIFQKKFLDKTKNNWEDREKFE
KVPGKYDMLEMDYTTNTQSEEESKGDSLKSPLKPESQLDLRVQELIELICNVQAMEETMV
EMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRVLMEACNEFYTRIPHDFGLR
TPPLIRTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRKLHCALHPLDHES
YEFKVISQYLQSTHAPTHRDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWV
GILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRVKDTGLLLLSEVALGQCN
ELLEANPEAERLLQGKHSTKGLGKMAPSPASFITLNGSMVPLGPASDTGVLNPEGYTLNY
NEFIVYNPNQVRMRYLLKVRFNFLQLW
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagacggcgggggacgcgcagcaatggggccggagcattagatgaagctgga
agagttcataatggcaacacagctatagaagaccctccgcctgcaaagaaaactcgaaga
tgccagaggcagggggtgaaaaaggagcctgtgaatggaggagaggccaataataacaaa
acagaaaacaagcaagagtccgtgaagaccttgctgttaaagggcaaagctcccgtggat
cctgagtgcacagccaaggtgggaaaggcccatgtgtactgtgaagggaatgatgtctat
gatgtcatgctaaatcagaccaatcttcagttcaataacaacaagtactatttgattcag
ctgttagaagatgatgcccagaagcacttcagcgtttggatgagatggggccgtgttggg
aaaatggggcagcacagcttggtggcttgctcaggggacctcaacaaagccaaggaaatc
tttcagaagaaattccttgacaaaacaaaaaacaattgggaggaccgtgagaagtttgag
aaggtgcctggaaaatatgatatgctagaaatggactataccaccaatacacagagtgaa
gaagaatcaaaaggggactctcttaaatcccctttgaaaccagaatcacagctagatctt
cgtgtgcaggagctgatagagttgatctgtaatgtccaggccatggaagaaacgatggta
gaaatgaaatacgacaccaagaaagccccactggggaagctgacagtggcacaaatcaag
gcaggctaccagtctctaaagaagattgaggactgtattcgggctggtcagcatggacga
gttctcatggaagcttgcaatgaattctacaccaggatcccacatgactttggactccgt
acccctccattaatccggacagagaaagaactgtcagacaaagtacaattactagaggct
ttgggagacattgaaattgccattaagctggtgaagacagagctgcaaagcccagaacac
ccattggaccaacactacagaaaactgcattgtgccctgcaccctctagaccatgaaagt
tatgagttcaaagtgatttcccagtacctgcagtctactcatgctcccacacacagggac
tataccatgaccttgctggatgtctttgaagtggagaaggagggtgagaaagaagccttc
agagaggaccttcataacaggatgctgctatggcatggttccaggcttagtaactgggtg
ggaatcctgagccatgggcttcgaattgccccacctgaggctcccatcacaggttacatg
tttgggaaaggaatctacttcgccgacatgtcttctaagagtgccaattactgctttgct
tctcgagtgaaggatactggactactacttttatcagaggtcgctttaggtcagtgtaat
gagctattagaggccaatcctgaggcagaaagattacttcagggcaaacatagcaccaag
ggactaggcaagatggctcccagtcctgcctccttcatcaccctgaatgggagtatggta
cccttaggaccagcaagtgacacaggagttctgaatccagagggttataccctcaactac
aatgaatttattgtctataaccccaaccaggtccgtatgcgatacctgctaaaggttcgg
tttaatttcctgcagctgtggtga

DBGET integrated database retrieval system