KEGG   Enhydra lutris kenyoni (northern sea otter): 111140721
Entry
111140721         CDS       T05871                                 

Definition
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk05160  Hepatitis C
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140721
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111140721
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111140721
   04625 C-type lectin receptor signaling pathway
    111140721
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111140721
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111140721
  09172 Infectious disease: viral
   05160 Hepatitis C
    111140721
   05171 Coronavirus disease - COVID-19
    111140721
   05164 Influenza A
    111140721
   05162 Measles
    111140721
   05168 Herpes simplex virus 1 infection
    111140721
   05167 Kaposi sarcoma-associated herpesvirus infection
    111140721
   05169 Epstein-Barr virus infection
    111140721
   05165 Human papillomavirus infection
    111140721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111140721
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    111140721
SSDB
Motif
Pfam: IRF IRF-3
Other DBs
NCBI-GeneID: 111140721
NCBI-ProteinID: XP_022348639
UniProt: A0A2Y9IMR7
LinkDB
Position
Unknown
AA seq 488 aa
MCPPTASVPLMLPATLVPRMASGRARCTRKLRNWVVEQVESGQFPGVCWEDAAKTMFRIP
WKHAGKQDFREDQDAAFFKAWAMFKGKYKEGDTEGPAIWKTRLRCALNKSSEFEEVPESS
HRDGAEPYKVYRLLPPSGTCPAQPGTQKSPSKRCHSSVSSEKEEEEGTTKNCMLSPSWLE
DPLRNEEVGANGGTGHSNFGSSSSSSNSPEPQEGADKTEGAPFQGDQVSLEFLPPPDSDY
SLLLTFIYGGRVVGEAQVQSLDCRLVAEPSGSQCGMEQVVFPKPDPREPTQRLLSQIERG
VLVASNSRGLFVQRLCPIPVSWNAPQAPPGPGPHLLPSNECVELFRTTYFCRDLVRYSRG
LGPPPKFQVTLNFWEESPSPSRTPNPKSLITVQVSSGWGETKPACVGGVGWGVPGEEGAS
GGKGAPRVVSSPAVLMTISSPPFLAQMEQAFARHLLEETPEEQAASLSLLQRLGDPLSSL
PLSSSYLL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtgtccccccacggcgtcagttccactgatgctgcctgcgacccttgtccccaggatg
gcatcaggcagggcccgctgcacccgaaagctgcggaactgggttgtagagcaagtggag
agcgggcagtttcctggggtgtgctgggaggatgccgccaaaacaatgttccggatcccc
tggaagcacgcgggcaagcaggacttccgggaggaccaggatgctgccttcttcaaggca
tgggcgatgtttaaggggaagtacaaggaaggagacacagaaggccctgccatctggaag
acacgtctacgctgtgccctcaataagagttctgaatttgaggaggttcctgagagcagc
catagagacggtgctgagccctacaaggtgtaccggctactgccgccatcagggacctgt
cctgcccagccagggacccagaagtcaccatcaaagcgatgtcacagttctgtgtcctct
gagaaggaggaggaggagggcaccacaaagaactgcatgctcagtccctcctggcttgag
gaccccctcagaaatgaggaggtgggggccaatgggggaacaggccattcaaactttggg
agcagcagcagcagcagcaacagccctgagcctcaggaaggtgcggacaaaactgaaggc
gcccctttccaaggagatcaggtgtcattggagtttctgcctcctccagactcagactac
tctctgctgctcaccttcatctatggcgggcgtgtggtgggagaagcccaggtgcagagc
ctggactgccgcctggtggctgagccctcagggtcccagtgcggaatggagcaggtggtc
tttcccaagcctgacccaagggagcctacccagcgcctgctgagccagattgagaggggc
gtcctggtcgccagcaattcccggggcctcttcgtgcagcgcctctgccctatccctgtc
tcctggaacgcgccccaggcacctcccggtccaggcccacatctgctgcccagcaatgag
tgcgtggagctcttccgaaccacctacttctgcagagacttggtcaggtactcccggggc
cttgggcccccccccaagttccaggtgacactgaatttctgggaggagagccccagcccc
agccgtaccccaaacccaaagagtcttatcacagtgcaggtgagttcagggtggggggag
accaagcctgcctgtgtgggtggggtggggtggggtgttccaggagaagaaggggcctcc
ggagggaaaggtgctcctagggtagtgtcttccccagctgtgctcatgaccatctcttcc
ccaccttttctggcacagatggagcaggcctttgcccgacatttgctggaggagactcca
gaggaacaggcagcctctctgtccctgctgcagaggctgggggacccactttcctccttg
cctctctcttcctcctatctcctttga

DBGET integrated database retrieval system