KEGG   Enhydra lutris kenyoni (northern sea otter): 111140799
Entry
111140799         CDS       T05871                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04664  Fc epsilon RI signaling pathway
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05221  Acute myeloid leukemia
elk05310  Asthma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111140799
   04151 PI3K-Akt signaling pathway
    111140799
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111140799
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111140799
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111140799
   04664 Fc epsilon RI signaling pathway
    111140799
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140799
   05202 Transcriptional misregulation in cancer
    111140799
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111140799
  09163 Immune disease
   05310 Asthma
    111140799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111140799
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111140799
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111140799
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Haparin
  Cytokines
   111140799
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 111140799
NCBI-ProteinID: XP_022348685
UniProt: A0A2Y9IRS3
LinkDB
Position
Unknown
AA seq 142 aa
MNSLPVLHLLLLLLGLQAPQAQGRSLLTYPPQQNFKMISEITDILNSSPSPAEETLDPNE
TNTLLNTTLLRPNLDAFLNATKNFYSNESLIWKNLKEFLPLLPTPTPRGEPISIENNWSD
FQKKLKKYLEALDNFLNFRNNH
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaacagcctccctgtcctgcaccttctcctgctcctgcttggactgcaagccccgcag
gcccaggggcggtccttgctgacatacccgcctcagcaaaacttcaagatgatcagtgaa
attacagacatcttaaacagttcaccctcgcctgcagaagaaaccttggacccaaatgag
acaaacaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacagcaacgaatcacttatctggaaaaatcttaaggaattcctgcca
ctcctgccgactcccacacccaggggagaaccaatctctattgagaataactggagtgat
ttccaaaagaagctgaaaaaatatctggaagcccttgataactttctgaatttcaggaac
aaccactga

DBGET integrated database retrieval system