KEGG   Enhydra lutris kenyoni (northern sea otter): 111140819
Entry
111140819         CDS       T05871                                 

Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04670  Leukocyte transendothelial migration
elk05100  Bacterial invasion of epithelial cells
elk05200  Pathways in cancer
elk05213  Endometrial cancer
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111140819
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111140819
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111140819
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111140819
  09162 Cancer: specific types
   05226 Gastric cancer
    111140819
   05213 Endometrial cancer
    111140819
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111140819
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111140819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111140819
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111140819
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 111140819
NCBI-ProteinID: XP_022348718
UniProt: A0A2Y9IJB2
LinkDB
Position
Unknown
AA seq 906 aa
MTSVHTGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEEGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgacttctgtccacacaggcaacataaactttaagtgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttggagcctcttgttacacaggtcacaactctggta
aacaccaatagtaaggggccctcaaataagaagagaggccgttccaagaaggcccatgtt
ttggctgcttctgttgaacaagcaactgagaattttttggagaagggggataaaattgca
aaggagagtcagtttctcaaagaagagcttgtggctgcagtagaagatgttcgaaaacaa
ggtgatttgatgaagactgctgcaggagagtttgcagatgatccctgctcttctgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttacccggctgcttatt
ttggctgacatggcagatgtctataaattacttgttcagctgaaagttgtggaagaaggt
attttgaaactgaggaatgctggcactgaacaagatttaggaatacagtataaagcccta
aaacctgaagtggataaactaaacattatggcagccaaaagacaacaggaactgaaagat
gtgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaatgttccaatc
ctctataccgcatcccaggcatgcctacagcacccggatgttgcagcctataaggctaac
agagacctgatctataagcagctgcagcaggcggtcacaggcatttccaatgcagcccaa
gccactgcatcagatgatgcttcccagcaccagggtgggggaggaggagaactggcatac
gcactcaataattttgataaacaaatcattgtggaccccttgagcttcagtgaggagcgc
tttagaccttccctggaggagcgcctagaaagcatcattagtggggctgccctgatggct
gactcgtcgtgcacgcgtgatgaccggcgtgagagaattgtggctgagtgtaatgctgta
cgccaggcccttcaggacctgctctcagagtacatgggcaatgctggacgtaaagaaaga
agcgatgcactcaattctgcaatagataaaatgaccaagaagactagggacttgcgtagg
cagctccgcaaagctgtcatggaccatgtttcagattcattcctggaaaccaatgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggaatatgcc
caagttttccgtgaacatgccaacaaattaattgaggttgccaacttggcctgttccatc
tcaaacaatgaagaaggtgtaaaacttgttcgaatgtcagcaagccagctggaagccctc
tgtcctcaggttatcaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacagtgggaaaaacaagtccgtgttcttacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagaaaatcacattttg
gaagatgtgaacaaatgcgtcattgctctccaggagaaagatgtggatgggctggaccgc
acagctggtgcgattcgaggccgggctgctcgggtcattcatgtagtgacctcagagatg
gacaactatgagccaggggtctacacagagaaggtgctggaagccacgaagctgctctcc
aacacagtcatgccacgttttacggagcaagtggaggcagccgtggaagccctcagctca
gaccccgcccagcccatggatgagaacgagtttatcgatgcctcccgcctggtgtacgat
ggcatccgggacatcaggaaagcagtgttgatgataaggacccccgaggaactggatgac
tctgactttgagacggaggacttcgatgtcagaagtaggacaagcgtccagacagaagat
gatcagctgatagctggccaaagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcagaacaggtggccagcttccaggaagaaaagagcaagctggatgcc
gaagtgtccaagtgggacgacagtggtaatgacatcatcgtgctggccaagcagatgtgc
atgattatgatggagatgacagacttcacccgaggtaaagggccgctcaaaaatacatca
gatgtgatcagtgccgccaagaaaattgcagaggctggatccaggatggacaagctcggc
cggaccattgcagaccattgcccagactcagcctgcaagcaggacctgctggcctacctg
cagcggattgccctctactgccaccagctcaacatctgcagcaaagtcaaggccgaggtg
cagaatctaggaggggagctcgtcgtctctggggtggacagtgccatgtccctgatccag
gccgccaagaacttgatgaatgcggtggtacagacagtgaaggcatcctacgtggcctcc
accaaataccagaagtctcagggcatggcttccctcaacctcccggctgtgtcgtggaag
atgaaggcacctgagaaaaagcccttggtgaagagagagaagcaggatgaaacacagacc
aagattaaacgggcatctcagaagaagcacgtgaaccctgtgcaggccctaagtgagttc
aaagccatggacagcatctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111144805
Entry
111144805         CDS       T05871                                 

Definition
(RefSeq) catenin alpha-3
  KO
K05691  catenin alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04670  Leukocyte transendothelial migration
elk05100  Bacterial invasion of epithelial cells
elk05200  Pathways in cancer
elk05213  Endometrial cancer
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111144805
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111144805
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111144805
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144805
  09162 Cancer: specific types
   05226 Gastric cancer
    111144805
   05213 Endometrial cancer
    111144805
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111144805
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111144805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111144805
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111144805
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 111144805
NCBI-ProteinID: XP_022354999
UniProt: A0A2Y9J5L1
LinkDB
Position
Unknown
AA seq 895 aa
MSAETPVTLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLA
SVEEATWNLLDKGEKIAQEATVLKKELTTALEEVRKESEALKVSAERFADDPCYLPKREA
VVQAARALLAAVTRLLILADMIDVMSLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKEKSPLLHSICSACLEHSDVASLQASKDT
VCEEIHNALNVISNASQGIQNMLAPPEPKAATLGSALDELENLIVLDPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLN
IAIDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYASIFRE
HTNRLIEVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALAARPKSQVVKKTME
MYKHTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDVDNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTTTAIPEFVTQVDVALEALNKNSLDV
FDDDQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSVQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKTISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPVQVMSEFRGRHVY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgaaacaccagtcacactgaatattgatcctcaggatctgcaggtccaaaca
tttactgtagagaagctactggagccactcataatccaggttactacacttgtaaattgt
ccccagaatccttccaacaggaaaaaaggacgttcaaaacgagccagagtcctcctagct
tctgtggaggaagcaacttggaatttattagacaagggggagaagattgctcaggaagcc
acagttttgaagaaggagcttactactgcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttgcagatgacccatgttatctccccaaaagggaggct
gtggttcaagctgcccgtgccttgttggctgcagttaccagactccttatccttgcagac
atgatagatgtcatgagtctcttgcagcacgtgtcagcttttcaaagaacatttgagtct
ctaaaaaatgtttccaataaatctgacctccagaaaacctaccagaagcttggaaaggag
ctggaaaatctggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agggatgaaattgcaggggcccgggcctcactgaaggagaagtccccgctcttgcattca
atttgctcagcttgtttggaacattctgatgttgcttccctccaagccagcaaggacaca
gtgtgtgaagaaattcacaatgccctcaatgtaatttcaaatgcttcacaaggcatccag
aatatgcttgctccaccagaacctaaggcagcaacactaggaagtgcccttgatgagctt
gagaatttaattgtcttggatccactcacagtgactgaggaagaaattagaccatctcta
gagaaacgtcttgaagccattatcagtggggctgcactattggctgactcttcatgcact
agagatttccatcgggaacggattattgcagaatgcaatgccattcgccaggctctccag
gacctgctttcagagtacatgaacaatactggaaaaaaggaaaggagtaataccctgaat
attgcaatagacaacatgtgtaagaagacaagggatcttcgcagacagctccgtaaagct
attatagatcatgtgtcagactcctttttggatacaacagtcccacttttggttctcatt
gaagctgccaagaatggccgagaaaaggaaataaaagaatatgcttcaatatttcgtgaa
cacaccaacagacttatagaggttgcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcagaattgcagccaatcacctggaaaccttgtgtccacagatcatt
aatgctgcacttgctttggcggcaagacccaaaagtcaagtggtcaaaaaaaccatggaa
atgtataagcacacgtgggagaatcatatccatgtcctcaccgaagctgtagatgacatt
acaagcattgatgacttccttgctgtatctgagagccatatccttgaagatgtcaacaag
tgtatcatagcattgagagaccaggatgttgataatttagaccgtgctgcaggtgctatc
agaggacgggcagcaagagttgctcacattgtcacaggtgaaatggacagttatgagcca
ggagcttacactgaaggtgtgatgagaaatgttaacttcctgacaactactgcaatacct
gagtttgtaacacaagtggatgttgccttagaagccttaaataaaaactctttggatgta
tttgatgatgatcaatttgtggacatctcaaagaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaagatgtttctgacttggaa
gaggaacatgaggtgcgcagtcacaccagcgttcagaccgaagggaaaactgacagagct
aagatgactcaattgcccgaggcagaaaaggaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaaactggatgctgagattgagatttgggatgataccagcaatgat
atcattgttctggccaagaagatgtgtatgattatgatggagatgacagacttcacaagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcggctaaaacgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaaccagtgtccggacccgtca
tgcaaacaagatttgttggcctatctggaacagattaagttttactctcaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtctgct
ttggacagcgtcacctccctgatccaagcagccaaaaatttaatgaatgctgtggtgcaa
acagtgaaaatgtcttacattgcttcaacgaagatcatccgaattcagagtcctgctggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaagcccttgattaaa
agagagaagccagaggaaacttgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
cacccagtgcaagtcatgagtgaatttagaggacggcatgtctactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111148019
Entry
111148019         CDS       T05871                                 

Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04670  Leukocyte transendothelial migration
elk05100  Bacterial invasion of epithelial cells
elk05200  Pathways in cancer
elk05213  Endometrial cancer
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111148019
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111148019
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111148019
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148019
  09162 Cancer: specific types
   05226 Gastric cancer
    111148019
   05213 Endometrial cancer
    111148019
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111148019
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111148019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111148019
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111148019
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 111148019
NCBI-ProteinID: XP_022360066
UniProt: A0A2Y9JHK9
LinkDB
Position
Unknown
AA seq 953 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLDKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacttcggcgacttcacctatcattttaaaatgggaccccaaaagtttggaaatccgg
acactaacggtggagaggcttttggagccacttgttacacaggtgacaacccttgtcaac
acgagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtactg
gcggcatctgtagagcaagccactcaaaacttcctggataagggtgaacagattgccaag
gagagccaagatctcaaagaagaattggtcgctgcagtagaggatgtgcgcaaacaaggt
gagacaatgcgcatcgcctcttcagagtttgctgatgacccgtgctcatcggtgaagcgt
ggcactatggtgcgggcagcgagggctttgctctcagctgtaactcgcctactcatcctg
gcagacatggcggatgtcatgagacttttgtctcatctgaaaattgtggaagaggccctg
gaagctgtcaagaatgctacaaatgagcaagatctcgcaaaccgctttaaagagtttggg
aaagaaatggtgaaacttaactacgtagcagcaagaagacaacaggagctgaaggaccct
cactgtcgggatgagatggctgccgcccgaggggctctgaagaagaacgctacaatgttg
tacacagcctcccaagcgtttctccgccacccggatgttgctgccacaagagccaaccga
gattatgtgtttaaacaagtccaggaggccattgctggcatctccaatgctgctcaagct
acctcgcccaccgatgaagccaaaggccacacaggcattggtgagctggctgcagctctc
aatgagttcgataataagataatcctggaccccatgaccttcagcgaggccaggttccgg
ccgtcgctcgaggagaggctagagagcatcatcagcggcgcggcgctcatggccgactcg
tcctgcacacgcgatgaccggcgcgagaggatcgtggccgagtgcaacgccgtccggcag
gcgctccaggacctgctcagcgagtacatgaacaacactggaagaaaagaaaaaggagat
cctctaaacattgcaattgataagatgaccaagaaaacaagagacctaaggagacagctt
cggaaagcagtgatggatcacatatctgattctttcttggaaaccaatgtccctttacta
gttctcattgaggctgcaaagagtgggaatgagaaggaagtgaaggaatatgcccaggtt
ttccgggagcatgccaacaagctggtggaggttgccaacttggcctgttccatttccaac
aatgaggaaggggtaaaattagtccggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgctgctctcacactggctgcccgaccacagagcaaagttgctcaggac
aacatggatgtcttcaaagaccagtgggagaagcaggtccgagtgctgacagaggctgtg
gatgacatcacctcagtggatgacttcctttctgtctcagagaatcacatcttagaggat
gtgaacaagtgtgtgatagccctccaggaaggggacgtggacaccctggaccggactgcg
ggggccatcagaggccgggcagctcgagtgatacacatcatcaatgcagagatggagaac
tatgaagctggtgtatatactgagaaggttctggaagctacaaaattgctctctgagaca
gtgatgccacgctttgccgagcaagtagaggtggctattgaagccctgagtgccaacgtc
cctcaaccatttgaagagaatgagttcattgatgcctctcgcctggtgtatgatggtgtt
cgagatatcagaaaagctgtgctgatgatcaggaccccggaagaactagaggatgattct
gacttcgagcaggaagattacgatgtacgcagccggacaagtgttcagactgaggacgac
cagctcattgcggggcagagtgcccgggccatcatggcgcaactaccgcaggaggagaag
gcaaaaatagctgagcaggtggagatattccaccaagagaaaagcaagctggatgccgaa
gtggccaagtgggatgacagcggcaatgatataattgtgctggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gttattaatgccgccaagaaaattgctgaagcaggttctcgaatggacaaattagcccgc
gcggtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagtacag
aatctcggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatgctggac
agtgccacatcactcatccaggcagctaaaaacctgatgaatgctgttgtcctcacggtg
aaagcatcctatgtggcctcaaccaaataccagaaggtctatggaacagcagctgtcaac
tcaccagttgtgtcttggaagatgaaggccccagagaagaagccccttgtgaagagagaa
aagcctgaagaattccagacacgagttagacgaggttcccagaagaaacacatttcgcct
gtacaggctttaagtgaattcaaagcaatggattcattctag

DBGET integrated database retrieval system