KEGG   Enhydra lutris kenyoni (northern sea otter): 111140945
Entry
111140945         CDS       T05871                                 

Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04371  Apelin signaling pathway
elk04912  GnRH signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05020  Prion disease
elk05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111140945
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111140945
   04928 Parathyroid hormone synthesis, secretion and action
    111140945
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    111140945
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111140945
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111140945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111140945
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    111140945
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 111140945
NCBI-ProteinID: XP_022348924
UniProt: A0A2Y9INL0
LinkDB
Position
Unknown
AA seq 543 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGTAGASEGSGG
NNSSSSSGGSGGGGGGSSGSSSGAFNPQGEAGEQPYEHLTAESFPDISLNNEKVLVETSY
PSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSASSPAASS
SSSASQSPPLSCAVQSSDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTSLQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKGVVASSAATSLSSYPSQVATSYTTPVTTSYPSPATTSYPSPVPTSYSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTTTFSPRTI
EIC
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggccgcagccaaggccgagatgcagctgatgtccccgctgcagatctccgacccgttc
ggctcctttcctcactcgcccaccatggacaactaccccaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtaccgccggggcctcggagggcagcggcggt
aacaacagcagcagcagcagcgggggcagtggaggtggagggggcggcagcagcggtagc
agcagcggcgccttcaaccctcagggggaggcgggcgagcaaccctacgagcacctgacc
gcagagtcttttcctgatatctctctgaataacgagaaggttctggtggagacaagttac
cccagccaaaccacccggctgccccccatcacctatactggccgcttctctctggagcct
gcacccaacagtggcaacaccttgtggcctgagcccctcttcagcctggtcagcggcctc
gtgagcatgaccaacccaccggccacctcatcttcagcatcatctccggcagcgtcctcc
tcctcctccgcctctcagagcccacccctgagttgtgcagtccagtccagtgacagcagc
cccatttactcagcggcaccaacgttccccacacctaacactgacatcttccctgagcca
caaagccaggcctttcccggctctgcgggcacttcgctccagtacccgcctcctgcctac
cctgctgccaagggtggcttccaagtccccatgatccctgactatctgtttccacaacag
cagggggacctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgt
acccagcagccttcactcactccactgtctaccatcaaggcctttgccacacagtcgggc
tcccaggacttgaaggccctcaacaccacctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgccccctcatgaacgcccgtatgcgtgc
ccggtggagtcctgtgaccgccgtttctcccgctctgatgagctcacccgccacattcgc
atccataccggccagaagcccttccagtgtcgcatctgcatgcgcaactttagccgcagt
gaccatctcaccacccacatccgcacccacacaggcgagaagcccttcgcctgcgacatc
tgtgggagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttaagg
cagaaggacaaaaaagcagacaaaggtgttgtggcctcttctgccgccacctccctctct
tcctacccctcccaggtggctacctcctacacgaccccagttactacctcttacccatcc
ccagccaccacctcatatccatcccctgtgcccacctcctactcctctcccgggtcatca
acctacccatcccctgtgcacagcggcttcccctcaccctcagtggccaccacatactcc
tctgttccccctgctttcccggcccaagtcagcagcttcccttcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacgacaaccttttctcccaggacaatt
gaaatttgctaa

DBGET integrated database retrieval system