KEGG   Enhydra lutris kenyoni (northern sea otter): 111141026
Entry
111141026         CDS       T05871                                 

Definition
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04668  TNF signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05134  Legionellosis
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111141026
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111141026
   04215 Apoptosis - multiple species
    111141026
   04217 Necroptosis
    111141026
   04115 p53 signaling pathway
    111141026
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111141026
   04621 NOD-like receptor signaling pathway
    111141026
   04622 RIG-I-like receptor signaling pathway
    111141026
   04625 C-type lectin receptor signaling pathway
    111141026
   04657 IL-17 signaling pathway
    111141026
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141026
   05203 Viral carcinogenesis
    111141026
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111141026
   05016 Huntington disease
    111141026
   05022 Pathways of neurodegeneration - multiple diseases
    111141026
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111141026
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111141026
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111141026
   05134 Legionellosis
    111141026
   05152 Tuberculosis
    111141026
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111141026
   05161 Hepatitis B
    111141026
   05160 Hepatitis C
    111141026
   05164 Influenza A
    111141026
   05162 Measles
    111141026
   05168 Herpes simplex virus 1 infection
    111141026
   05163 Human cytomegalovirus infection
    111141026
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141026
   05169 Epstein-Barr virus infection
    111141026
   05165 Human papillomavirus infection
    111141026
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111141026
   05142 Chagas disease
    111141026
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111141026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111141026
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     111141026
Peptidases and inhibitors [BR:elk01002]
 Cysteine peptidases
  Family C14: caspase family
   111141026
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 111141026
NCBI-ProteinID: XP_022349064
UniProt: A0A2Y9IKC4
LinkDB
Position
Unknown
AA seq 485 aa
MNFSKCLYNIGEQLDSDELASLKFLSMDYIPQKKQEPIKDPLMLFQRLQEKRLLEENNLS
FLKELLFRINRLDLLVTYLDTSKQEMEQELRIPGRAQISAYRVMLFQISEDVSKLELKSF
KFLLSQEISRCKLHDDLNLFDIFIEMEKRVILGERNLDTLKRICDQINRSLLKKITDYEE
LSQEQTVIPQRSLDEISNDMSQLLVGEKSLRVPPMSDSPREQNCESETSEKVYQMESKPR
GYCLIFNNYDFSIARKQVPKLHSIKDRNGTDLDADALCQTFSELHFEIVPFRDSTAKKIC
DVLKSYQSMDHTTRDCFICCILSHGDKGIIYGCDGQEVPIYELTSYFTGSKCPSLAGKPK
IFFIQACQGDNYQKGIAVETDSEQNEACYELDSCQKRYIPDDADFLLGMATVNNCVSYRN
PMEGTWYIQTLCQSLRKRCPRGEDILTILTEVNFEVSNKDDRRNMGKQMPQLTFTLRKKL
IFPCD
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaattttagtaaatgcctctataatattggagaacagctggacagtgacgagctggcc
tccctcaaattcctgagcatggactacatcccccagaagaagcaggagcccatcaaggat
cccctgatgttattccagagactccaggaaaagagactgttggaggaaaacaacctgtcc
ttcttgaaggagctgctttttcggatcaacagactggacctgctggtcacctacctggac
accagcaagcaggagatggagcaagagcttcggatcccaggcagagcccagatctctgct
tacagggtcatgctttttcagatttcagaagatgtaagcaaattggaattgaagtccttt
aagtttcttttgagccaggagatctctagatgtaaactgcacgatgatttgaacttgttt
gatattttcatagagatggagaagagggtcatcctcggggaaagaaatttggacaccctg
aaaagaatctgtgaccaaataaacaggagcctgctgaagaaaatcacagattacgaagaa
ttaagccaagagcaaacagtgatccctcaaagaagtctagatgaaatttcaaatgatatg
tctcagttgcttgtaggggagaaatccctgagggtaccgccaatgtcggactctccaaga
gaacagaactgtgaatcagagacatcggaaaaagtttaccaaatggaaagcaaacctcga
ggatattgtttgatctttaacaattatgactttagcatagcacggaagcaagtgcccaaa
cttcacagcattaaggataggaatggaacagacttggatgcagatgctttgtgtcagacc
tttagtgagcttcattttgagattgtgcctttcagagactctacagctaagaaaatctgt
gacgttctcaaatcctaccaaagcatggaccacactaccagggactgcttcatctgctgc
atcctctcccatggagacaagggcatcatctatggctgtgatggacaggaagtccccatc
tatgagttgacctcttacttcactggttctaagtgcccttcccttgcaggcaagcccaaa
atcttttttatccaggcttgtcaaggggataactaccagaaagggatagctgttgagacc
gactctgaacagaatgaagcctgttatgaattggactcctgtcagaagagatatatccca
gacgatgctgactttctgctggggatggccactgtgaataattgtgtttcctaccgaaac
cccatggagggaacatggtatatccagacgctttgccagagcctgagaaaaagatgtcct
aggggagaagatattctcaccatccttactgaagtgaattttgaagtgagcaataaggat
gacaggagaaacatgggcaaacaaatgccacaactgaccttcacactgaggaaaaaactc
attttcccttgtgactga

DBGET integrated database retrieval system