KEGG   Enhydra lutris kenyoni (northern sea otter): 111141059
Entry
111141059         CDS       T05871                                 

Definition
(RefSeq) aldehyde oxidase 4-like isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00280  Valine, leucine and isoleucine degradation
elk00350  Tyrosine metabolism
elk00380  Tryptophan metabolism
elk00750  Vitamin B6 metabolism
elk00760  Nicotinate and nicotinamide metabolism
elk00830  Retinol metabolism
elk00982  Drug metabolism - cytochrome P450
elk01100  Metabolic pathways
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111141059
   00350 Tyrosine metabolism
    111141059
   00380 Tryptophan metabolism
    111141059
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    111141059
   00760 Nicotinate and nicotinamide metabolism
    111141059
   00830 Retinol metabolism
    111141059
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    111141059
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141059
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     111141059
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Ald_Xan_dh_C Fer2_2 Fer2 DUF218
Other DBs
NCBI-GeneID: 111141059
NCBI-ProteinID: XP_022349099
UniProt: A0A2Y9IP21
LinkDB
Position
Unknown
AA seq 1343 aa
MMASIPNSDELIFFVNGRKVVEKNADPEVNLLYYLRKVHILIFYYIYLTGTKYSCGSGGC
GACTVMVSRYNPKTKEIRHSPVTACLVPICSLHGAAVTTVEGVGSISTRIHPVQERLAKC
HGTQCGFCSPGMVMSIYTLLRNHPEPTLEQITKAIGGNLCRCTGYRPIIESGKTFCEETT
VCGLKGSGKCCMDQEERSFINRQEKMCTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPNK
RRLTFQGERTTWIAPVTLNDLLELKVSFPEAPLVMGNTAVGPSIKFKGEFHPVFISPLGL
PELCFVDYTDDGVTIGAGYSLAQLSDALHLTVLEQPKEKTKTYRALLKHLRTLAGAQIRN
MATLGGHVVSRPNFSDLNPILAAGNATINLISKEGERQIPLNSLFLERSPEASLKSEEIV
LSVYIPHSTQWHFVSGLRLAQRQENAFAIVNAGMSVKFEDGTDTIKDLQMFYGSVGPTVV
SASRTCKQLLGRPWDDHMLSDACQWVLDEIYIPPAAKGGMVEYRRTLIVSLLFKFYLRVR
RGLNKMDPQKFPDIPEKSMSALEDFHIKTPQGIQMFQCVDPHQSPQDPVGHPVMHQSAIK
HATGEAVFSDDMPPFAQELFLAVTTSTRAHAKIISIDASEALALPGVVDVITAEDVPGAN
NHQGEILYAQNEVICVGQIVCTVAADTYAHAREAAEKVKITYEDIEPRIITIEQALEHNS
FLSIEKKVEQGNVEQAFKNVDQILEGEAHVEGQEHFYMETQTILAIPKQEDKEMVLYLGT
QFPSHVQEFVAAALNVPRNRIACHIKRIGGGFGGKVTKPALLGAISAVAANKTGRPIRFI
LERGDDMLITAGRHPLLGKYKIGFMNNGVIKAADVEYYINGGCTPDESESVMEYIVLKSD
NAYHIPNFRCRGRPCKTNLPSNTAFRGYGFPEAAVVVEAYITAVASHCDLSPEEVKEINM
YKRISKTTYKQTFDPEPLRRCWKECLEKSSFSARKLAAEEFNKKSYWKKRGLAVIPVKFT
VGFPVGYYSQAAALVHIYLDGSVLVTHGGCEMGQGLHTKIIQVASRELNIPQSYIHLSET
STVTVPNASFTAASMGTDINGKAVQNACQILMARLQPIIRKNPKGRWEDWITKAFTESIS
LSATGYFKGYQTHMDWEKEKGEPFAYYVYGAACSEVEVDCLTGAHKLLRTDIFVDAAFSI
NPAVDVGQIEGAFIQGMGLYTTEELKYSPEGVLYSRSPDDYKIPTVTEIPEKFYITLLRS
RNPIAIYSSKGLGETAVFLGSSVLFAIFDAVTAAREERGLTKIFNLKSPATPEFIRMTCV
DQFTDMIPRDDPSTFTPWSIRVS
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgatggcttctattcccaattctgatgaactgattttttttgtgaatggaagaaaggtt
gtagagaagaatgctgatcctgaagtaaacctactgtactacctgaggaaagtccatatc
cttatattttactatatctacctcacaggcaccaagtacagctgtggaagtggaggctgc
ggcgcctgcactgtcatggtgtcaagatacaatcccaagaccaaggagatccgccactct
ccagttacagcgtgcctggtgcccatctgctctctgcatggggctgctgtcacaacagtg
gaaggcgtaggaagcatcagcaccaggattcatcccgtgcaggaaagacttgccaagtgt
catggcacacagtgtggcttctgtagcccagggatggtgatgtccatctacacgctgctg
aggaaccacccagagccaaccctagagcagataaccaaagctattggaggtaatttgtgc
cgctgtactggataccgaccaattatagaaagtggaaaaactttctgtgaggaaacaact
gtttgtggactgaaaggatcaggaaaatgctgcatggatcaagaagagaggtcttttata
aatagacaagaaaaaatgtgtaccaaactgtataatgaagatgaattccagcccttggat
ccatcccaggaacctatattccctcctgaactaataagaatggcagaagatccaaacaaa
agaagactgacgttccaaggggagaggactacctggattgcccctgtgacccttaatgac
cttctggagctgaaagtcagtttccctgaagcccccctcgtcatggggaatactgcagta
ggacccagcattaaatttaaaggtgaattccatccagttttcatatctccccttgggctt
ccagaactgtgttttgtggactacacagatgatggggtgaccataggtgcaggatacagc
ctggcccagctgagtgatgccttacacctcactgttttggagcaaccaaaggagaagact
aagacttaccgtgccctcctgaagcatctgaggacacttgctggagcccagataaggaat
atggcgactttagggggacatgtggtgagcagacctaatttttctgacctaaatcccatt
ttagcagcaggaaatgctaccatcaatctgatatctaaagaaggagaacggcagattcct
ttaaacagccttttccttgagagatcacctgaagccagccttaaatccgaagagattgtg
ttatctgtttatattccccactctactcagtggcactttgtgtccggactccggctggcc
cagcgtcaggagaacgcttttgccattgtcaatgccggcatgagtgtgaagtttgaagat
ggtacagacacgattaaggaccttcaaatgttctacggaagtgttggccccactgttgtc
tctgcaagccgaacgtgcaagcagctccttgggaggccgtgggatgaccacatgctgagt
gatgcctgccagtgggtcctggatgagatttacatcccgccagcagccaagggtggcatg
gtagagtacaggagaaccctcatcgtcagtttactcttcaaattctacctcagagtgagg
cgaggattgaataaaatggatccccagaagtttcctgatatcccagaaaaatccatgagt
gctctagaagatttccacataaaaacaccccaaggaattcagatgttccagtgcgtggat
ccccaccaatccccacaagaccctgtcggccacccagtcatgcaccagtcagccatcaaa
cacgctacaggggaggctgtatttagtgatgacatgccgccttttgcccaagaactcttc
ctggctgtaacaaccagcaccagagctcatgcaaagatcatatcaattgatgcttcagaa
gccctggcccttccaggtgttgttgatgtgataacagcagaggacgtcccaggagctaat
aaccatcagggagagattctctatgctcagaatgaggtgatttgcgtgggtcagattgtc
tgcacggtggccgctgacacctatgctcatgcaagagaggcggctgagaaagtgaagatc
acttacgaagacatagaaccacggattatcaccattgagcaagcactagagcacaattca
tttctttccattgaaaagaaagtggagcaaggaaatgtagaacaagcctttaaaaatgtt
gatcaaatccttgaaggcgaggcccatgtagaagggcaggaacatttctacatggagacg
caaactatcctggctatcccaaaacaggaagataaagaaatggtgctataccttggaaca
cagtttccaagccatgtgcaggaatttgtggctgcagcattaaacgtcccaaggaataga
attgcctgccacataaaaagaatcggaggagggtttggaggaaaagtgaccaagcctgct
ctgctaggagccatcagtgccgtggccgccaacaagactggccgcccaatccggtttatt
ctagagcgtggtgatgacatgctgataactgctggccgccacccactcctcggaaaatac
aaaatcggattcatgaacaacggtgtgatcaaagctgcagacgttgaatattatatcaat
ggtggatgcactcctgacgagtctgagtcggtaatggagtacattgtgctgaaatccgac
aacgcatatcatattcctaatttccggtgccggggtaggccctgcaaaacaaacttgcca
tccaacacggccttccgaggatatggcttccccgaggctgcagtggtagtggaagcttac
ataaccgctgtggcgtctcactgtgacttatcccccgaagaggttaaagaaataaacatg
tataagagaattagcaaaacaacatacaagcagacatttgatccagagcccttgcgaaga
tgctggaaagaatgcctggagaaatcttcattctctgctaggaaactggctgcggaggaa
tttaacaaaaagagctactggaagaagagggggcttgccgtgatccccgtgaagtttact
gttgggttccctgtgggctactacagtcaggctgctgctctagtccacatctatcttgat
ggctccgtcctggtgactcatggtggctgtgaaatgggacaaggccttcacaccaaaatt
attcaggtggccagtcgagaactgaacatcccgcagtcgtacatacacctgtccgaaacg
agcaccgtcacagtgcccaatgctagcttcacggcggcgtcgatgggaacagacatcaac
gggaaagctgtgcagaatgcctgccaaattcttatggcccgtcttcagccaatcatcagg
aaaaaccctaaaggaagatgggaggactggattacaaaagccttcacagaatccatcagt
ctctcagctactggatatttcaaaggctaccagactcacatggactgggagaaggagaag
ggtgagccctttgcgtactatgtgtatggagcggcctgttcggaggttgaagtggactgt
ctgaccggggctcacaagctcctgaggactgacatcttcgtggatgctgctttcagcata
aacccagccgtggacgtcggacagattgaaggagcatttatccagggcatggggttgtac
accacagaggaactgaaatattccccggaaggtgttctctactctcgaagtccagatgac
tacaaaatcccaactgtcactgagataccagaaaagttctatatcactttgttgcgttcc
cgaaatcccatagccatctactcgtccaaggggttgggtgagactgcagtgttcttggga
tcctccgtgttgttcgccatttttgatgcagtgactgctgcccgcgaagagagggggctg
accaagatcttcaacctgaagagcccagcaactcctgagtttattaggatgacttgtgtg
gatcaatttactgacatgattcctagagatgatccttcaacatttacaccttggtccatc
cgtgtatcttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142784
Entry
111142784         CDS       T05871                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00280  Valine, leucine and isoleucine degradation
elk00350  Tyrosine metabolism
elk00380  Tryptophan metabolism
elk00750  Vitamin B6 metabolism
elk00760  Nicotinate and nicotinamide metabolism
elk00830  Retinol metabolism
elk00982  Drug metabolism - cytochrome P450
elk01100  Metabolic pathways
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111142784
   00350 Tyrosine metabolism
    111142784
   00380 Tryptophan metabolism
    111142784
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    111142784
   00760 Nicotinate and nicotinamide metabolism
    111142784
   00830 Retinol metabolism
    111142784
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    111142784
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142784
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     111142784
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 111142784
NCBI-ProteinID: XP_022351792
UniProt: A0A2Y9ISV8
LinkDB
Position
Unknown
AA seq 1343 aa
MPCPSKSDDLVFFVNGRKVIERNVDPEVTLLTFLRKNLRLIGTKYACGRGGCGACTVMVS
KRDPLSAKIRHFSITACLVPICSLYGAAVTTVEGVGSINTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHQQPSEEQLLEALGGHLCRCTGYRPILAGGRTFCVESDGCRQKGTG
KCCLDPGGNDASSLHRESDICTELFAEDEFQPLDPTQELIFPPELLRMAEKPEKQTLTFR
GERVTWISPGTLKDLLELKAKHPEAPVVSGNTSLGPAMKSQGHFYPILLSPARIPELSVV
SKTSDGLTVGAGCSLAHVKDILAERVSELPEEKTQTYRALLKQLKTLAGQQIRNMASLGG
HIISRHCYSDLNPVLAVGNATLNVISEEGTRQIPLNEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNAGMRVLLREGTDTIEDLSVSYGGVGATTISTQKSC
RQLVGRSWNELMLEEACRLLLEEVSLPGWAPGGKVEFKRSLVVSFFFKFYLEVLQALKKL
AKFMPDGHHYPEISDHFLSALEDFPITGPQGVQRYQSVDSRQALQDPVGRPIMHLSGLKH
ATGEAIFCDDIPMVDRELFMVLVTSTRAHAKIISIDWSEALELPGVVDVIRAEDIPGTNG
TEEDKLMAADEVLCVGHIICAVVAETDVQAKSAAEKINITYEDLEPVIFTISDAIKHNSF
LCPEKKLEQGNVEEAFDQVDQIVEGEVHVGGQEHFYMETQRVLVIPKAEDKELDIYVSTQ
DPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGKPAVFGAIAAVGAIKTGRPVRLVL
DREDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFLNGGCMLDDSELVTEFLILKLEN
AYKIRNLRFRGWACMTHLPSNTAFRGFGFPQGTLITESCITAVAAKCGLPPEKIREKNMY
KTVDKTIYKQAFSPETLIRCWNECLDKSSFHSRRMQVEEFNKKNYWKKKGMAIVPMKFSV
GFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSSVHICETS
TAMVPNTVATAASIGSDVNGRAVQDACQILLKRLEPIIKKNPDGTWEDWIEAAFEQRISL
SATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRADIVMDACCSLN
PAIDIGQVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPAIADVPEEFNVSLLPSS
QNPPTIYSSKGLGESGMFLGSSVFFAITDAVAAAHRERGIAEDFTVRSPATPEWVRMACA
DRFTEMIPRDDPKTFKPWSIPIA
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgccttgcccatcgaagtcggatgacttggttttctttgtgaatgggagaaaggtgata
gagaggaatgtggacccagaagtcactctgctgaccttcctccgaaagaacctacgcctc
ataggaaccaaatacgcctgcggaagaggaggctgcggggcctgcaccgttatggtgtct
aagcgcgacccactgtctgcgaagatcagacacttctccatcactgcgtgcctggtgccc
atctgctctctgtatggggctgctgtcaccaccgtggaaggtgttggaagcatcaacacc
aggcttcaccctgtgcaggagaggattgccaagagccacggcacccagtgtggcttctgc
acgcctgggatggtgatgtctatgtacacgctgcttaggaaccaccagcagccctcagag
gagcagctcctggaagccctgggaggtcatctttgccgctgcaccgggtatcggcccatt
ctcgcaggtggaaggaccttctgtgtggagtcagatggctgtcgacagaaaggaacagga
aaatgctgcttggatcccggaggaaatgatgcttcctcactccacagggaaagtgatatt
tgcacagagttatttgcagaagacgagttccagcccttggaccctacccaggagctcata
tttcccccagaactcttgagaatggcagagaagccagaaaaacaaactctgacctttcgt
ggagagagggttacctggatctcccctggcaccctcaaggatctcctggagctgaaagcc
aaacatcctgaagcccctgtcgtctcaggcaacacctccctgggacctgcaatgaaatct
caaggacatttttacccaattctcctctctcctgctaggattcctgagctcagtgtggta
tccaaaacaagtgatggactgacggtaggtgctggctgcagtctggcccacgtgaaagac
atcttggctgagcgagtttccgagcttccagaggagaaaactcagacgtaccgagccctc
ctgaagcagctgaagactctggcgggccagcagatccggaatatggcatccttaggagga
cacattataagtcggcactgctattcggatctgaatccagttttggctgtgggcaacgct
accctcaatgtgatatcagaagaaggtacacggcagattcctctaaatgaacattttctt
gccgggttggcaagtgcagaccttaagccggaggaaattttggaatctgtgtacatccct
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccagcaaaacgcc
ttagccgatgtgaacgctggcatgcgagtcctcctccgggaaggcacagacaccattgag
gacctgagtgtctcctatggaggggttggggccacgacgatcagcacacagaaatcctgc
cgacagctcgtggggaggtcctggaatgagctgatgctggaggaagcctgccggctgctt
ctggaagaagtctccctcccaggctgggctccaggggggaaagtggaattcaagaggtct
ctggtggtcagtttcttcttcaaattctacctggaagttctgcaggcactgaagaagctg
gccaagtttatgcctgacggtcatcattatcctgaaatttcagaccacttcctaagtgct
ctagaagatttccccatcacaggaccgcagggagtacagaggtaccagagtgtggattct
cgccaggccctccaagacccagtgggacgccccatcatgcacctctcaggtcttaaacat
gcgacaggtgaagccatattttgtgatgacattccgatggtggatagagagcttttcatg
gttttggtgaccagcaccagagcccatgcaaaaatcatatcaattgattggtctgaggcc
cttgaactacctggggtggttgatgtgataagagctgaggacattccaggcaccaacggg
actgaggaggataagctgatggctgcagatgaggtgctctgcgtgggccacatcatctgt
gctgtggttgcagagaccgatgtacaggcaaagagcgcagctgaaaagataaacatcacc
tacgaagatctggagcccgtgatcttcaccatcagcgatgccataaagcacaactcattc
ctatgccctgaaaaaaaacttgaacaaggaaatgttgaggaggcatttgatcaagttgat
caaattgttgaaggagaggtccatgttggaggacaggaacatttttatatggaaacacag
agagtgcttgttattccgaaggcggaggacaaagaactggacatttatgtgtcaacacag
gatccagcccacgtgcagaaaacagtgtcctccactttaaacatccccatcaacaggatc
acctgtcacgtcaagcgggtgggcggagggtttggcgggaaggtaggaaaaccagctgtg
tttggagctattgcagctgtgggcgctatcaaaactggtcgtcccgtccgtcttgttctt
gatcgcgaagacgatatgttaataactgggggaaggcacccattatttggaaaatataaa
gtggggttcatgaacaatgggagaatcaaagctctggacattgagtgcttccttaacgga
ggatgcatgctggacgactccgagctggtaacagaatttcttatattaaagctggaaaat
gcatataaaatccgcaacctcaggttccgcggctgggcatgcatgacacatctaccatca
aataccgcctttcggggatttggcttcccacaaggaaccctaataacagaatcttgcatc
acagctgtggcagccaaatgtggccttccgccagaaaagattagggagaaaaacatgtac
aaaacagttgataaaaccatctacaaacaagcattcagccctgagaccctgataagatgt
tggaatgagtgtctggacaagtcttcctttcacagcagaagaatgcaagtggaagagttt
aacaagaagaattattggaagaagaaaggcatggcaatcgtccccatgaagttttcagtc
ggctttgctgccacaagctatcatcaggcagctgccctcgttcatatctacacggatggc
tctgtattggtcacccatggaggcaacgaactgggacaaggtattcacaccaaaatgctg
caggtggccagccgtgaactgaaaatccccatgtcctcggtgcacatctgtgaaacaagt
acggccatggtacccaacaccgtcgctacagcagcttccatcggctcagacgtgaacggc
agagccgtgcaggatgcttgtcagatccttctgaaacgccttgagcccatcattaagaaa
aatccagacggtacatgggaagactggatagaagctgcttttgaacaaagaatcagtctt
tcggccactggatacttcaggggctacaaggccttcatggactgggagaagggagaagga
gacccttttccatactatgtctatggagcagcctgttccgaggttgaaattgactgcctg
acgggagctcacaagaaaatcagagcggacatcgtcatggatgcgtgttgcagcctaaac
cctgccattgacattgggcaggttgagggttcctttattcagggaatgggcctttatacc
actgaagaactaaaatattccccagaaggtgttctgtactctcgaggcccagacgagtac
aaaattccagccatcgctgacgtcccagaggagttcaatgtctccctgttgccatcatca
caaaacccgccaaccatctattcctccaagggcctgggggagtccgggatgttcctgggc
tcatctgtgttcttcgccatcactgacgcggtggctgcagcccacagggaaaggggcata
gccgaggacttcacagtgaggagcccagcgacaccagaatgggttcgaatggcctgtgcg
gatcggttcacagagatgatcccaagagatgacccgaagacatttaaaccttggtccatc
cctatagcataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153602
Entry
111153602         CDS       T05871                                 

Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00280  Valine, leucine and isoleucine degradation
elk00350  Tyrosine metabolism
elk00380  Tryptophan metabolism
elk00750  Vitamin B6 metabolism
elk00760  Nicotinate and nicotinamide metabolism
elk00830  Retinol metabolism
elk00982  Drug metabolism - cytochrome P450
elk01100  Metabolic pathways
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111153602
   00350 Tyrosine metabolism
    111153602
   00380 Tryptophan metabolism
    111153602
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    111153602
   00760 Nicotinate and nicotinamide metabolism
    111153602
   00830 Retinol metabolism
    111153602
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    111153602
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111153602
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     111153602
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 111153602
NCBI-ProteinID: XP_022368477
UniProt: A0A2Y9K4J5
LinkDB
Position
Unknown
AA seq 1338 aa
MEPAAELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGTGGCGACTVMISRYT
PNTKKISHHAANACLIPICSLYGAAVTTIEGIGSTKAGIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPSLEQITEALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCC
LDQGINELTEFEEGNKTSTKLFSEEEFLPLDPTQELIFPPELMIMVEKQPQGTRIFVGDR
MTWISPTTLTELLEAKFNYPQAPVVMGNTSVGPEMKFKGVFHPVIISPDGIEELNFANCS
HNELTLGAGLSLTQVKYILGEVIQNLPEEKTRMYQALLKHLRTLAGSQIRNMASLGGHIV
SRHLDSDLNPLLAVGNCTLNLLSKKGQRQVPLNEEFLRRCPSADLQPEEILISVNIPHSR
KWEFVSGFRQAQRQQNALAIVNSGMRVFFGEGDGIIRELCISYGGVGPTTVCAKNSCQKL
IGRPWNEEMLDAACRLVLDEVTLPGSAPGGRVEFKRTLIISFLFKFYLEVSQFLKGMDPV
HYPSLADKDASALEDLHSRHHSSTLKYQSVDSKQLPQDPIGHPIMHLSGIKHATGEAIYC
DDMPTVDQELFLSFVTSSRAHAKIVSIDLSEALSLPGVVDIVTEEHLHGVNSFSILTKPE
ELLRTEEVSCVGQLVCAVVAESKVQAERAAKRVKFVYEDLQPLILTIEEAIQHSSFFEPE
RKLEYGNVDEAFKGVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEIDVYVSTQYPKY
VQDIVASTLKLPANKVMCHVKRVGGAFGGKTFKTGIMAAITAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRIVALDMEHYNNGGASLDESLLVVEMGLLKMENAYKF
PNLRCRAWACRTNLPSNTALRGFGFPQVGLITESCITEVAARCGLAPEKVRTINMYKEID
QTPYKQEINAKNLIQCWKECMAKSSYTLRKAAVEKFNSKNYWKKKGLAVVPLKFPVGLGS
VTIGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNIHLRGTSTETI
PNTNVSGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKDWAQAAFDESISLSATG
YFRGYESNMNWETGEGHPFQYFVYGAACSEVEIDCLTGAHKNIRTDVVMDAGCSINPALD
IGQIEGAFIQGVGLYTIEELQYSPQGVLHTRGPNQYKIPAVCDIPTELHISFLPPSQSSN
TLYSSKGLGESGLFLGCSVFFAIHDAVNAARRERGLFGPLKLSSPLTPEKIRMACEDKFT
KMIPRDKPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggagccggcggcggagctgctcttctacgtgaacggccgcaaggtaatagaaaaaaat
gttgatcctgaaacaatgctgttaccatatctgaggaagaagcttcgactcacaggaact
aagtacggctgtggaacaggtggctgtggtgcctgcacagtgatgatatcacgatacacc
cccaataccaagaagataagccatcatgccgccaatgcctgtctgatccccatctgctcc
ctgtacggggctgctgtcaccacgatagaaggcataggaagcaccaaggccgggattcat
cctgttcaggagaggatagccaagtgtcacggcacgcagtgtgggttctgcacccctgga
atggtgatgtccatctacacattgctgaggaaccatccagagccttctctggagcagata
acggaagcccttggtggtaacctatgccgttgcactggatataggcccataattgatgca
tgcaagactttctgtaaaacttctggctgctgtcaaagtaaagaaaatggggtttgctgt
ctggatcaaggaataaatgaattaacagaatttgaagaaggaaataagacaagtacaaaa
ctcttctcagaagaggagtttctgccattggatccaactcaagaattgatatttcctcca
gagctaatgataatggttgagaaacaaccacaagggaccaggatttttgttggtgataga
atgacatggatttctccaacgaccctgacggaacttctagaagcaaaattcaactaccct
caggcccctgttgtcatggggaacacctctgtaggtcctgaaatgaaatttaagggtgtc
tttcacccagttataatttctcccgatggaattgaagaactgaattttgcaaactgttca
cataatgagctgaccttaggtgctggcctcagcctgactcaggtgaagtacatcttgggt
gaagtaatccagaacctcccagaggagaagacacggatgtaccaagctctcttgaagcat
ttgcgaactctggctggatctcagatcaggaacatggcctctttagggggccatatcgtg
agcaggcacctagattcagatctgaatcccctcctggccgtgggcaactgtaccctcaac
ttgctatcaaaaaaaggacaacgacaggttcctttaaacgaggagtttctcagaaggtgc
cccagtgcagatctgcagcctgaagagatcctgatctcagtgaacataccccactcaagg
aagtgggaatttgtgtcaggcttccgacaagcccagcgccaacagaatgcgcttgccata
gtcaattccggaatgagagtcttttttggagaaggagatggcatcatccgagagttatgc
atctcgtatggaggtgttggtccaaccactgtctgtgcaaagaattcctgccagaaactc
atcggaaggccctggaatgaagagatgttggacgcggcttgcaggctggttctggacgaa
gttacccttccaggctcagctccgggcgggagggtggagttcaagaggaccctcatcatc
agcttcctcttcaagttctacctggaagtgtcgcagtttctgaaggggatggatcctgtt
cactatcctagccttgcagacaaggatgcaagtgccttagaagaccttcattccagacat
cactccagtaccttaaagtaccagagtgtagactctaagcagctccctcaagacccaatt
ggccatcccatcatgcacctgtctggtattaagcatgccacgggtgaagccatctactgt
gacgacatgcctaccgtggaccaggagcttttcttgtcttttgtaacaagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcctgcctggcgtggtggac
attgtgactgaggaacatcttcatggtgtaaactccttctccattttaaccaaaccggag
gaacttctgaggacagaggaggtgtcctgtgtgggccagcttgtctgtgccgtggtcgcg
gagtccaaggttcaggcagagcgagcagccaagcgagtgaagtttgtctacgaagatttg
cagccactgatcctgacaatcgaggaagccatacaacacagctccttcttcgaaccagag
aggaaactggaatatggaaatgttgatgaagcatttaaaggggttgatcagattctagaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccagagcatgcttgtt
gttcccaaaggagaggaccaagaaatcgatgtctatgtttctacacagtatcccaaatac
gtacaggacatcgttgcttcgaccctgaagctcccagctaacaaggtcatgtgtcatgtc
aagcgtgttggtggggcttttggggggaagactttcaaaaccggcatcatggcagccatc
accgcatttgccgccaacaaacacggccgcgctgtccgctgtgttctggagcggggagaa
gacatgttgatcactggaggccgccacccttaccttggaaagtacaaagctgggttcatg
aacgatggcagaatcgtggccctggacatggagcattataacaatgggggtgcctccctg
gacgagtcgttacttgtggtagaaatgggacttctgaaaatggaaaatgcttacaagttt
cccaacctgcgctgccgggcgtgggcgtgcagaaccaacctgccatccaacacagctctg
cgtggctttggcttccctcaggtggggctcatcactgagtcctgtatcaccgaagttgca
gccaggtgtggtctggcccccgagaaggtccgaacaataaacatgtacaaggaaattgat
caaacaccctacaaacaagagattaacgccaagaacctgattcagtgttggaaagaatgt
atggccaagtcttcctataccctgaggaaagcggctgtggaaaaattcaattcaaagaat
tattggaagaagaaagggctggctgtggtccccctgaagtttcctgttggccttggctca
gtcactattggtcaggctgctgccttggttcacatttacctggacgggtctgtgctggtg
actcacggtgggatcgaaatgggtcagggggtccacactaaaatgattcaggtggtcagt
cgtgaactaaggatgccgatgtctaacatccacctgcgcggaacgagcacagaaaccatc
cctaacacgaacgtctctggaggttccgtggtggccgatctcaacgggctggccgtgaag
gatgcttgtcagactctactaaaacgccttgaacccatcatcagcaagaatcctcaaggc
acttggaaggattgggcacaagctgcttttgatgaaagcattagcctttcagctactgga
tacttcaggggctatgagtccaacatgaactgggagacaggcgaaggccatcctttccag
tattttgtttacggagctgcctgttccgaggtggaaatagactgcctgacgggcgctcat
aagaacatcagaacagacgttgtcatggacgccggctgcagcataaatccagcccttgac
ataggccagattgaaggcgcgtttattcaaggcgtggggctttatacaatagaggagcta
cagtattctcctcagggtgtcctacacactcgcggtccaaaccagtataaaatccctgcc
gtctgcgacatccccacggagctgcacatttctttcttgcccccgtctcaaagctcaaat
accctgtattcctcaaagggtctaggagagtctgggctattcctgggctgttcagtgttt
tttgccattcatgacgcggtgaacgcagcacgacgggagagaggcctgtttggaccatta
aagctcagcagtccgctgaccccagagaagattcgaatggcctgtgaagataagttcaca
aaaatgatcccgagagacaaacctggatcctatgttccttggaatgtacccatatga

DBGET integrated database retrieval system