KEGG   Enhydra lutris kenyoni (northern sea otter): 111141099
Entry
111141099         CDS       T05871                                 

Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04672  Intestinal immune network for IgA production
elk05140  Leishmaniasis
elk05200  Pathways in cancer
elk05310  Asthma
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141099
   04151 PI3K-Akt signaling pathway
    111141099
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141099
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141099
   04660 T cell receptor signaling pathway
    111141099
   04658 Th1 and Th2 cell differentiation
    111141099
   04659 Th17 cell differentiation
    111141099
   04657 IL-17 signaling pathway
    111141099
   04664 Fc epsilon RI signaling pathway
    111141099
   04672 Intestinal immune network for IgA production
    111141099
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141099
  09163 Immune disease
   05310 Asthma
    111141099
   05320 Autoimmune thyroid disease
    111141099
   05321 Inflammatory bowel disease
    111141099
   05330 Allograft rejection
    111141099
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111141099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141099
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141099
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111141099
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Haparin
  Cytokines
   111141099
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 111141099
NCBI-ProteinID: XP_022349139
UniProt: A0A2Y9IP66
LinkDB
Position
Unknown
AA seq 132 aa
MGLTSQLIPTLVCLLALTGTFIHGHNFSIAIKEIIKTLNILTARNDSCMKLTITEVFTAP
KNTSEKEIFCRAATVLQQLSTHNCSNRLLRGLHRNLRNMANTTCSVNEVKKSTLKDFLER
LKVIMQQKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccggcact
ttcatccacggacataacttcagtattgccattaaggagatcatcaaaacattgaacatc
ctcacagcgagaaacgactcgtgcatgaagctgaccatcaccgaagtcttcactgcccca
aagaacacaagtgagaaggaaatcttctgcagagctgcaactgtgcttcagcagctctct
acacacaattgctccaacagattgctcagaggacttcacaggaacctcaggaacatggca
aacacgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg
ctaaaagtgatcatgcaacagaaatactacaggcactga

DBGET integrated database retrieval system