KEGG   Enhydra lutris kenyoni (northern sea otter): 111141144
Entry
111141144         CDS       T05871                                 

Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05171  Coronavirus disease - COVID-19
elk05205  Proteoglycans in cancer
elk05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111141144
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111141144
   04915 Estrogen signaling pathway
    111141144
   04928 Parathyroid hormone synthesis, secretion and action
    111141144
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111141144
  09162 Cancer: specific types
   05219 Bladder cancer
    111141144
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111141144
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111141144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141144
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111141144
SSDB
Motif
Pfam: EGF Syndecan
Other DBs
NCBI-GeneID: 111141144
NCBI-ProteinID: XP_022349203
UniProt: A0A2Y9IPD1
LinkDB
Position
Unknown
AA seq 208 aa
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTGNLDSPTESTDQLLAPEGGRGRE
VLNLEETDLDLLRAAFSSKPQALATPSKEERGKKKKKGKGLGRKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHKRGGYDVESEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagtgctctcggcgttg
gtgactggcgagagcctggagcggcttcggagagggctggcagctggaaccggcaacctg
gactctcccaccgaatctacagaccagctactggccccggaaggcggccggggcagggaa
gtcctgaacttagaagagacagacctggaccttttaagagctgctttctcctcgaagcca
caggctctggccacacccagcaaggaggagcgtgggaaaaaaaagaagaaaggcaagggg
ttagggaggaagagagacccttgtcttcggaaatacaaggacttctgcatccatggtgaa
tgcaaatatgtgaaggagctccgggctccatcctgcatctgccaccctggttaccacgga
gagaggtgccatgggctgagcctcccagtggaaaatcgcttatatacttatgaccataca
accatcctggctgtggtggccgtggtgctgtcgtccgtctgtctgcttgtcatcgtgggg
cttctcatgtttaggtaccataagagaggaggttatgatgtggaaagtgaagagaaagtg
aagttgggcatgactacttcccactga

DBGET integrated database retrieval system