KEGG   Enhydra lutris kenyoni (northern sea otter): 111141239
Entry
111141239         CDS       T05871                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk04650  Natural killer cell mediated cytotoxicity
elk04657  IL-17 signaling pathway
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk05146  Amoebiasis
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05171  Coronavirus disease - COVID-19
elk05202  Transcriptional misregulation in cancer
elk05221  Acute myeloid leukemia
elk05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111141239
   04668 TNF signaling pathway
    111141239
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111141239
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111141239
   04650 Natural killer cell mediated cytotoxicity
    111141239
   04660 T cell receptor signaling pathway
    111141239
   04657 IL-17 signaling pathway
    111141239
   04664 Fc epsilon RI signaling pathway
    111141239
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111141239
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111141239
  09163 Immune disease
   05323 Rheumatoid arthritis
    111141239
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111141239
   05171 Coronavirus disease - COVID-19
    111141239
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141239
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111141239
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111141239
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111141239
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     111141239
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111141239
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Cytokines
   111141239
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 111141239
NCBI-ProteinID: XP_022349369
UniProt: A0A2Y9IPV4
LinkDB
Position
Unknown
AA seq 153 aa
MWLQNLLFLGTVVCSISAPTSLPRPVTRPSRHVDAIQEALSLLNKSSDETAVMNEPVKVV
SGMFDRQEPTCLQTRLQLYSEGLRGSLISLKQPLTLMANHYKQHCLETPETPCAIQTITF
RSFKENLKEFLFNIPFDCWQPEATEAGPTRSQP
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttttcctgggcactgtggtctgcagcatctctgcacccacc
agcttacccagacctgtcactcgaccctctcggcacgtggatgccatccaagaggccctg
agccttctgaacaaaagtagtgatgagactgctgtgatgaatgaaccagtaaaagtcgtc
tctggaatgtttgaccgccaggagccgacatgcctgcagacgcgcctacagctgtacagt
gaaggcctgcggggcagcctcatcagcctcaagcaacccttaaccctgatggccaaccac
tacaagcagcactgcctcgaaaccccggaaactccctgtgcaatccagactatcaccttc
agaagtttcaaagaaaacctgaaggaatttctgtttaacatcccctttgactgctggcag
ccagaagcaacagaggccggtccaaccaggagccagccctga

DBGET integrated database retrieval system