KEGG   Enhydra lutris kenyoni (northern sea otter): 111141244
Entry
111141244         CDS       T05871                                 

Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04916  Melanogenesis
elk04934  Cushing syndrome
elk05132  Salmonella infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05221  Acute myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111141244
   04390 Hippo signaling pathway
    111141244
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111141244
   04550 Signaling pathways regulating pluripotency of stem cells
    111141244
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111141244
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141244
  09162 Cancer: specific types
   05210 Colorectal cancer
    111141244
   05225 Hepatocellular carcinoma
    111141244
   05226 Gastric cancer
    111141244
   05216 Thyroid cancer
    111141244
   05221 Acute myeloid leukemia
    111141244
   05217 Basal cell carcinoma
    111141244
   05215 Prostate cancer
    111141244
   05213 Endometrial cancer
    111141244
   05224 Breast cancer
    111141244
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111141244
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111141244
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111141244
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141244
   05165 Human papillomavirus infection
    111141244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111141244
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111141244
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111141244
NCBI-ProteinID: XP_022349378
UniProt: A0A2Y9ILA1
LinkDB
Position
Unknown
AA seq 419 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGVPGAGTGARGEAEVGGEALGREHASQRLFPDKLPESLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTPAPGD
ISQKQGVHRPLQTSDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKVEKEAK
KPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESNTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgccgcagctggactccggcgggggcggcgcgggcgggggcgacgacctgggcgcgcct
gacgaactgctggccttccaggacgagggcgaggagcaggacgacaagagtcgcgacagc
gccgcgggccccgagcgcgacctggccgagctcaagtcgtcgctggtcaatgagtccgag
ggcgcggcgggcggcgcaggggtcccgggggccggcaccggggcccgcggcgaggcggag
gtcgggggtgaggcgctcggacgggagcacgcttcgcagagacttttccccgacaaactt
ccagagtctctggaggacggcctgaaggccccagagtgcgccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactaccctcccccctcgggagcagggcag
cacccccagccgcagcccccgctgcacaacaaagccagtcagccagcccacagcgtcccg
caactctctcctctctatgaacatttcagcagcccacaccctacacctgcaccaggcgac
atcagccagaaacaaggagttcacaggcctctgcagacctccgacctctctggcttctac
tctttgacctcaggcagcatgggacaactcccccacactgtgagctggcccagccctcct
ctctaccccttgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctaccccaggttcacccacccatccctgatgctgggctctggtgtacct
ggtcaccctgcagccatcccccacccggccatcgtacctccctcagggaagcaggaactg
cagccgtatgaccgcagcctgaagacacaggcagaatccaaggtggagaaggaagccaag
aagccaaccatcaagaagcccctcaacgccttcatgctgtacatgaaggagatgagagcc
aaggtcattgcagagtgcacactcaaggagagtgctgccatcaaccagatcttgggtcga
aggtggcatgcactgtctcgggaagagcaagccaagtattatgagctggcccgaaaggag
aggcagctgcacatgcagctgtacccaggctggtcagcgcgggacaattatgggaagaag
aaaaggcggtctcgggaaaagcaccaggaatccaacacaggaggaaaaagaaatgcattc
ggtacttacccggagaaggccgctgccccagccccgttccttccgatgacagtgctgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111145217
Entry
111145217         CDS       T05871                                 

Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04916  Melanogenesis
elk04934  Cushing syndrome
elk05132  Salmonella infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05221  Acute myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111145217
   04390 Hippo signaling pathway
    111145217
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111145217
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111145217
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145217
  09162 Cancer: specific types
   05210 Colorectal cancer
    111145217
   05225 Hepatocellular carcinoma
    111145217
   05226 Gastric cancer
    111145217
   05216 Thyroid cancer
    111145217
   05221 Acute myeloid leukemia
    111145217
   05217 Basal cell carcinoma
    111145217
   05215 Prostate cancer
    111145217
   05213 Endometrial cancer
    111145217
   05224 Breast cancer
    111145217
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111145217
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111145217
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111145217
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111145217
   05165 Human papillomavirus infection
    111145217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111145217
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111145217
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111145217
NCBI-ProteinID: XP_022355664
UniProt: A0A2Y9J7I6
LinkDB
Position
Unknown
AA seq 625 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPP
HMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLN
AFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYP
GWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNN
WCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPQDAKSQTEQTQPLS
LSLKPDPLAHLSMMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPILSSSLAQPST
SSLHSHNSLAGTQPQPLSLVTKSLE
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacaaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatctccagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcacca
gcacacattgtctcgaacaaagtgccggtcgtgcagcaccctcaccatgttcaccccctc
acgccgctcatcacgtacagcaatgagcacttcaccccgggaaacccacctccacacttg
cccgctgacgttgaccccaaaacaggaatcccacggcctccgcaccctccagatatatct
ccatattacccgctatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcagggtcagccagtgtacccaatcacgacaggaggattccgtcacccctac
cccacagctctgactgtcaatgcttccatgtccagcttcctgtcttccaggttccctccc
catatggtcccaccacatcacactctacatacgaccggcatcccccacccggccatagtc
acgccaacagtcaaacaggaatcctcccagagtgacgtcggctcactccacagctcaaag
catcaggactccaaaaaggaagaagaaaagaagaagccccacataaagaaacctcttaat
gcgttcatgttgtatatgaaggaaatgagggcaaaggtcgtggcggagtgcacgttgaaa
gaaagtgcggccatcaaccagatcctggggcgaaggtggcacgcactgtccagagaagag
caagcaaagtactacgagctggcccggaaggagcgacagcttcacatgcagctgtacccc
ggctggtctgcgcgggacaactatgggaagaagaagaagaggaaaagggacaagcagcct
ggagagaccaatgaacacagcgaatgtttcctaaatccttgcctttcacttcctccgatt
acagacctgagcgctcctaagaaatgccgagcgcgctttggccttgatcaacagaataac
tggtgcggcccttgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagc
tgcctcagtccaccctcttcagatggaagcttactagactcgcctcctccctcccccaac
ctgctaggctcccctccccaagacgccaagtcacagactgagcagacccagcctctctcg
ctgtccctgaagcccgaccccctggcgcacctgtccatgatgcctccgccgcccgccctc
ctgcttgccgaggccgcccacggcaaggcccccgccctctgtcccaacggggccctggac
ctgcctcctgccgccctgcagccgcccatcctgtcctcctctcttgcacagccgtcaaca
tcttccttacattcccacaactctctggccgggacccagccccagccgctgtccctcgtg
accaagtcgttagaatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111148131
Entry
111148131         CDS       T05871                                 

Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04916  Melanogenesis
elk04934  Cushing syndrome
elk05132  Salmonella infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05221  Acute myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111148131
   04390 Hippo signaling pathway
    111148131
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111148131
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111148131
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111148131
  09162 Cancer: specific types
   05210 Colorectal cancer
    111148131
   05225 Hepatocellular carcinoma
    111148131
   05226 Gastric cancer
    111148131
   05216 Thyroid cancer
    111148131
   05221 Acute myeloid leukemia
    111148131
   05217 Basal cell carcinoma
    111148131
   05215 Prostate cancer
    111148131
   05213 Endometrial cancer
    111148131
   05224 Breast cancer
    111148131
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111148131
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111148131
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111148131
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111148131
   05165 Human papillomavirus infection
    111148131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111148131
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111148131
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111148131
NCBI-ProteinID: XP_022360259
UniProt: A0A2Y9JKX1
LinkDB
Position
Unknown
AA seq 588 aa
MPQLGGGGGGGGGGGGGGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRD
LDEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPG
YPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPV
VQPPHHMHPLTPLITYSNDHFPPGSPPTHLSPEIDPKTAGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKSCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPESRAQLALHSAAFLSAKATATSSGQMGSQPP
LLSRPLPLGSLPTALLTSPPSFPAALHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcgggggcggcgggggcggcgggggcggcggcggcggctcg
ggcgccggggcggccggcggaggggacgatctcggggcgaacgacgagctgatccccttc
caagacgaggggggcgaggagcaggagccgagcagcgacagtgcctctgcgcagcgggac
ttggacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggac
tcggaggcggagaggcgcccgcagcccgcccgggacgccttccagaagccgcgggactat
ttcgccgaagtgagaaggccccaggacggcgcgttctttaagggccccccgtaccctggg
tacccgttcctgatgatcccggacttgagcagtccgtacctctccaatggacccttgtct
cccggaggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtcccctccagt
gccacggtcaaggacaccaggtcaccatccccagcacacttgtctaataaagttcctgtt
gttcagcccccacatcacatgcacccgttgacgcccctcatcacctacagcaacgaccac
ttcccccctggctcccctcccacgcacctctccccagagatcgacccaaagacagcagga
atcccccggccccctcacccatctgagctgtctccatattacccactgtctcccggagct
gttggacaaatcccccatcccctcggctggctcgtcccgcagcaaggacagcccatgtac
tccctgcctcctggtggtttccggcacccctaccctgccctcgccatgaacgcctcaatg
tccagcctggtttccagtcggttctctcctcacatggtggctcctgcccatcccggtctg
cccacctcagggattccccaccccgccatcgtctcccccatcgtcaagcaggagccggcg
ccccccagcctcagcccggcggtgagcgcgaaatcaccagtcacggtgaaaaaggaggaa
gaaaagaaaccccacgtgaaaaagcctctgaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcggccatcaaccagatcctg
ggaagaaagtggcacaacctgtcccgggaagaacaggccaagtactatgaactggcccgg
aaggagcggcagcttcactcccagctctacccgacctggtcagcccgggacaactacggt
aagaaaaagaagaggaagagagaaaagcagctgtcacagacacagtcccagcagcaagtc
caagaggctgagggtgctctggcctccaaaagcaagaagccatgtgtccagtacctgccc
cctgagaagtcctgtgacagccccgcctcctcccacggcagcatgctggactccccggcc
accccctccgcagccttggcatccccggctgcccccgcagcgacccactcggagcaagcc
cagcccctctctctcaccaccaagccggaaagccgggcccagctggctttacactcggct
gccttcctgtcagccaaggcgacagccacctcctctggccagatgggcagccagcccccg
ctcctgtcccggcccctccccctcgggtccctgcccacagctctgctgacttctccccca
tccttcccggccgcgctccatgcccaccaggcccttccagtcctccaggcccagcctctt
tccttggtcaccaagtctgcccactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154120
Entry
111154120         CDS       T05871                                 

Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04916  Melanogenesis
elk04934  Cushing syndrome
elk05132  Salmonella infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05221  Acute myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111154120
   04390 Hippo signaling pathway
    111154120
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111154120
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111154120
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154120
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154120
   05225 Hepatocellular carcinoma
    111154120
   05226 Gastric cancer
    111154120
   05216 Thyroid cancer
    111154120
   05221 Acute myeloid leukemia
    111154120
   05217 Basal cell carcinoma
    111154120
   05215 Prostate cancer
    111154120
   05213 Endometrial cancer
    111154120
   05224 Breast cancer
    111154120
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111154120
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111154120
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111154120
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111154120
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111154120
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111154120
NCBI-ProteinID: XP_022369235
UniProt: A0A2Y9KIU2
LinkDB
Position
Unknown
AA seq 415 aa
MPQLSGAGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVN
ESEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPN
MNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVN
SKQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSM
SRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHI
KKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLH
MQLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcggcggcgggggagacccggaactctgcgct
accgacgagatgatccccttcaaagatgagggcgatcctcagaaggagaaaatcttcgca
gaaatcagtcaccccgaagaggaaggcgacttagccgacatcaagtcctccttggttaac
gagtctgaaatcatcccggccagcaacggacacgaggtggccagacaagcgcaaacctct
caggagtcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatgga
ggtctctacaataagggaccctcctactcaagttattccgggtacataatgatgccaaat
atgaataatgacccatacatgtcaaatggatctctttctccacccatcccaagaacatca
aataaggtgccagtggtgcagccatcacatgcggtccatcctctcacccccctcatcacg
tacagcgacgagcacttttctccaggatcacacccctcacacctcccatcagatgtcaac
tccaaacaaggcatgtccagacatcctccagctcctgagatccctactttttaccccctg
tctccaggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatat
cccatcacgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatg
tccaggttttcccatcacatgattcctggtcctcctggtccccacacaactggcatccct
catccagctattgtaacacctcaggtcaaacaggagcacccccacactgacagcgaccta
atgcacgtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacatt
aagaagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgttgct
gagtgtaccttaaaagaaagcgcagctatcaaccagattctcggcagaaggtggcatgcc
ctctcccgtgaagagcaggctaaatattatgaattagcacggaaggaaagacagctacac
atgcagctctacccgggctggtctgcaagagacaattatggtaagaagaagaagaggaag
agagagaagctccaggaatcgacgtcaggtggaaaacgaagctcattcccaacgtgcaag
gccaaggcagcgaccccgggacctctgctggagatggaagcttgttga

DBGET integrated database retrieval system