KEGG   Enhydra lutris kenyoni (northern sea otter): 111141312
Entry
111141312         CDS       T05871                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04024  cAMP signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04724  Glutamatergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05012  Parkinson disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05034  Alcoholism
elk05142  Chagas disease
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111141312
   04020 Calcium signaling pathway
    111141312
   04072 Phospholipase D signaling pathway
    111141312
   04024 cAMP signaling pathway
    111141312
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111141312
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111141312
  09152 Endocrine system
   04911 Insulin secretion
    111141312
   04922 Glucagon signaling pathway
    111141312
   04923 Regulation of lipolysis in adipocytes
    111141312
   04912 GnRH signaling pathway
    111141312
   04913 Ovarian steroidogenesis
    111141312
   04915 Estrogen signaling pathway
    111141312
   04921 Oxytocin signaling pathway
    111141312
   04926 Relaxin signaling pathway
    111141312
   04935 Growth hormone synthesis, secretion and action
    111141312
   04918 Thyroid hormone synthesis
    111141312
   04928 Parathyroid hormone synthesis, secretion and action
    111141312
   04916 Melanogenesis
    111141312
   04924 Renin secretion
    111141312
   04925 Aldosterone synthesis and secretion
    111141312
   04927 Cortisol synthesis and secretion
    111141312
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111141312
   04270 Vascular smooth muscle contraction
    111141312
  09154 Digestive system
   04970 Salivary secretion
    111141312
   04971 Gastric acid secretion
    111141312
   04972 Pancreatic secretion
    111141312
   04976 Bile secretion
    111141312
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111141312
   04961 Endocrine and other factor-regulated calcium reabsorption
    111141312
  09156 Nervous system
   04724 Glutamatergic synapse
    111141312
   04728 Dopaminergic synapse
    111141312
   04726 Serotonergic synapse
    111141312
   04730 Long-term depression
    111141312
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111141312
  09159 Environmental adaptation
   04713 Circadian entrainment
    111141312
   04714 Thermogenesis
    111141312
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141312
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111141312
  09165 Substance dependence
   05030 Cocaine addiction
    111141312
   05031 Amphetamine addiction
    111141312
   05032 Morphine addiction
    111141312
   05034 Alcoholism
    111141312
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111141312
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111141312
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111141312
   05165 Human papillomavirus infection
    111141312
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141312
   05142 Chagas disease
    111141312
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111141312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111141312
   04031 GTP-binding proteins [BR:elk04031]
    111141312
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111141312
  Exosomal proteins of other body fluids (saliva and urine)
   111141312
  Exosomal proteins of colorectal cancer cells
   111141312
  Exosomal proteins of bladder cancer cells
   111141312
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    111141312
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 111141312
NCBI-ProteinID: XP_022349479
UniProt: A0A2Y9IQ63
LinkDB
Position
Unknown
AA seq 249 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSAAQVFPEPPESDHEHEEGDLELSLPECLEYEEEFDYESETETETESESE
IESETDFETEPETAPATEPETEPEDERGPVVPKHTTFGQSLTERLHALRLRSPDASPSRA
QPSTQEPQNPRQGEEPEPQPEDKDPRDPEESEEPKEKKQQRRCKPKKPTRRDPSPESPSK
RGPIPIRRH
NT seq 750 nt   +upstreamnt  +downstreamnt
atggatcgtaggtcccgggctcagcagtggcgccgagctcgccacaactacaacgatctg
tgcccacccatcggccgccgagcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgcgcccagcagcgcgcggccgcccagcag
cgccggagcttccttaacgcccaccaccgctccgccgcccaggtgttccccgagcccccc
gaatctgaccacgagcacgaggagggagacctcgagctgtccctccccgagtgcctagag
tacgaggaagagtttgactacgaatctgagaccgagaccgagaccgagtccgagtctgaa
atcgaatccgagaccgacttcgagaccgagcctgagaccgcccccgccactgagcccgag
accgagccagaagacgagcgcggccccgtggtgccaaagcacaccaccttcggccaatct
ctcaccgagcgtctgcacgctctgagattgcggagccccgacgcctccccgagtcgcgcg
cagcccagcactcaggagccccagaaccccagacagggggaggagcccgagccccagccc
gaggacaaggatccgagggaccccgaagaatccgaggagccaaaggagaagaagcagcag
cgccgctgcaagccgaagaagcccacccgccgcgacccatccccagagtccccttccaaa
aggggacccatccccatccggcgtcactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141614
Entry
111141614         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04024  cAMP signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04724  Glutamatergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05012  Parkinson disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05034  Alcoholism
elk05142  Chagas disease
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111141614
   04020 Calcium signaling pathway
    111141614
   04072 Phospholipase D signaling pathway
    111141614
   04024 cAMP signaling pathway
    111141614
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111141614
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111141614
  09152 Endocrine system
   04911 Insulin secretion
    111141614
   04922 Glucagon signaling pathway
    111141614
   04923 Regulation of lipolysis in adipocytes
    111141614
   04912 GnRH signaling pathway
    111141614
   04913 Ovarian steroidogenesis
    111141614
   04915 Estrogen signaling pathway
    111141614
   04921 Oxytocin signaling pathway
    111141614
   04926 Relaxin signaling pathway
    111141614
   04935 Growth hormone synthesis, secretion and action
    111141614
   04918 Thyroid hormone synthesis
    111141614
   04928 Parathyroid hormone synthesis, secretion and action
    111141614
   04916 Melanogenesis
    111141614
   04924 Renin secretion
    111141614
   04925 Aldosterone synthesis and secretion
    111141614
   04927 Cortisol synthesis and secretion
    111141614
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111141614
   04270 Vascular smooth muscle contraction
    111141614
  09154 Digestive system
   04970 Salivary secretion
    111141614
   04971 Gastric acid secretion
    111141614
   04972 Pancreatic secretion
    111141614
   04976 Bile secretion
    111141614
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111141614
   04961 Endocrine and other factor-regulated calcium reabsorption
    111141614
  09156 Nervous system
   04724 Glutamatergic synapse
    111141614
   04728 Dopaminergic synapse
    111141614
   04726 Serotonergic synapse
    111141614
   04730 Long-term depression
    111141614
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111141614
  09159 Environmental adaptation
   04713 Circadian entrainment
    111141614
   04714 Thermogenesis
    111141614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141614
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111141614
  09165 Substance dependence
   05030 Cocaine addiction
    111141614
   05031 Amphetamine addiction
    111141614
   05032 Morphine addiction
    111141614
   05034 Alcoholism
    111141614
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111141614
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111141614
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111141614
   05165 Human papillomavirus infection
    111141614
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141614
   05142 Chagas disease
    111141614
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111141614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111141614
   04031 GTP-binding proteins [BR:elk04031]
    111141614
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111141614
  Exosomal proteins of other body fluids (saliva and urine)
   111141614
  Exosomal proteins of colorectal cancer cells
   111141614
  Exosomal proteins of bladder cancer cells
   111141614
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    111141614
SSDB
Motif
Pfam: G-alpha Arf Roc
Other DBs
NCBI-GeneID: 111141614
NCBI-ProteinID: XP_022350014
UniProt: A0A2Y9IRQ9
LinkDB
Position
Unknown
AA seq 1019 aa
MGVRNCLDGNNMSGQRDIPLELGEQSEQPSLEAPGAAAPSPGPGAAEEMETEPPHSEPVP
LEIEGEACGPPEVSRPNFQDVGEAIEEAGAHGGYSPPPEEAMPFEVEQPCSGGFWPTPEQ
PGDTAGACAGLEVFGPTLVEPGAFGDARPGLGGYSPPPEEAMPFEFEQPAQGGGSQPPLQ
VSDLAPGGPGAGVFSTPPQEPQALRPANADFGGDRSPPPEEAMPFEFDGAAFGDDSPPPG
LPRAIPQIDGGGGSGQSAAAAVSSAVLLAPAANEPPLWVPAAIGSPSREAVRSPPHLAGD
SPPMEISGPPLEIGSAPVGVDDAPVNMDSPPIALDGPPIEVSRAPVKRERAEGERPPVEG
EAAEMEGGSAAAAAEGGKVPSPGDGAPDAGAKPAAPAAGAATAAPDTPAAGAAAPAAPDA
PAAGAAPAAPDAPAAPAAPAAPAAPAAPAAGAAAPAARAAPAAPASGARPKLRFLRPPSP
EIQAADPPTPQPTRAFAWRGRSGRSRDDDEGSVSSDDHSSDESDDGTSGCRRWLQPRRNR
RRRKPRRNLLRNFLMQAFGGCFGRSESPQPKASHSPKVKKIPLAEKRRQMRKEALEKRAQ
KRAEKKRSKLIDKQLQEEKMGYMCTHRLLLLGRKVVPSNTEGRFRLDKPASATVRXPPVP
GWGPARKKGASGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDI
KNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWE
DEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVD
KVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKS
IWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVT
RAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacgcgatatccccctt
gaactcggggaacagtccgagcaaccatctttggaggccccaggggcagctgcccccagt
cctgggcctggcgcagccgaagagatggagaccgaaccgcctcacagcgagcccgtcccc
ctcgagattgaaggcgaggcctgtggacccccagaggtctccaggcccaacttccaggac
gtgggagaggccatcgaggaagcaggagcccatggaggctacagcccacctcctgaggaa
gccatgcccttcgaggtcgagcagccctgctcaggaggcttctggcctaccccggagcag
cctggagacaccgctggggcctgtgcaggcctggaggtctttggcccaacgctcgtggag
cccggagccttcggtgatgccagaccaggcctgggaggctacagccctccacctgaagaa
gccatgccctttgagtttgagcagcctgcccagggaggtggcagccagcctcccctgcag
gtctcagacctcgctccaggaggcccaggtgcgggggtctttagcacgcctccccaggag
ccccaagctctcagacctgcaaacgcagactttggaggagaccgcagccctccccctgag
gaggctatgccatttgagtttgatggagcagcctttggggacgacagcccaccccctggg
ctcccccgagctatcccacaaatcgacggcggcggcggcagcggccagtccgcggcagcc
gcggtctcgagtgcggtcctcctcgctcccgccgcgaacgagccccccctctgggtccca
gccgccatcggcagcccatcccgagaggctgtcagatctcctccacacctcgcgggcgac
agccccccgatggagatctccggacccccgctcgagattggcagcgcccccgttggggtc
gacgacgctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcgag
gtctcccgagccccagttaagagagagcgagcagagggagagagacccccagttgaggga
gaagcagccgagatggaaggaggctcagccgcagctgctgcggaaggaggaaaagtcccc
tctccgggggacggagccccagacgccggggccaagcctgctgctccagccgccggggca
gccacggctgcccctgacactccagccgccggggcagccgctcctgccgcccctgacgct
ccagccgccggggcagccccagccgcccctgacgctccagccgctccagccgccccagcc
gccccagccgccccagccgctccagccgccggggcagctgctcctgccgcccgggcagcc
cctgccgcccctgcgtctggagcccgacccaagctccgcttccttagaccccccagcccc
gagatccaggctgccgatccgcctactccgcagcctactcgcgcatttgcctggcggggc
aggtctggccgcagtcgcgacgacgacgaggggtcggtcagcagcgacgaccacagcagc
gatgagtccgacgatgggacctccggatgccgccgctggctgcagccccggcgaaatcgc
cgccgccgaaagccccggcgcaacttgctccgcaacttcctcatgcaggccttcgggggc
tgcttcggccgatccgagagcccccagcccaaagcctcgcacagccccaaggtcaagaag
attcccctggcggagaagcgcagacagatgcgcaaggaagccctggagaagcgcgcccag
aagcgcgcagagaagaaacgcagcaagctcatcgacaaacaactccaggaggaaaagatg
gggtacatgtgtacgcaccgcctgctgcttctagggagaaaagtggtgccgagcaacact
gagggtcgtttccggctggacaagccagcgtcagcgaccgtaagantgcccccagtcccg
gggtgggggccggcaagaaagaagggggcttcaggtgccggagaatctggtaaaagcacc
attgtgaagcaaatgaggatcctgcatgttaatgggtttaatggagagggcggcgaagag
gatccgcaggctgccaggagcaacagcgatggtgagaaggcgaccaaagtgcaggacatc
aaaaacaacctgaaggaggcgatcgaaaccatcgtggccgccatgagcaacctcgtgccc
cccgtggagctggccaaccccgagaaccagttcagagtggactatattctgagcgtgatg
aacgtgcctgactttgatttccctcctgagttctatgagcacgccaaggctctgtgggag
gacgaaggagtgcgcgcctgctatgagcgctccaacgagtaccagctcatcgactgtgcc
cagtacttcctggacaagattgatgtcatcaagcaggctgactatgtgcccagcgatcag
gatctgcttcgctgccgcgtcctgacttctggaatctttgagaccaagttccaggtggac
aaagtcaacttccacatgtttgacgtgggcggccagcgcgatgagcgccgcaaatggatc
cagtgcttcaatgatgtgactgccattatcttcgtggtggccagcagcagctacaacatg
gtcattcgggaggacaaccagaccaaccgcctgcaggaggctctgaacctcttcaaaagc
atctggaacaacagatggctgcgcaccatctctgtgattctgttcctcaacaagcaagac
ctgctagcggagaaagtccttgctggaaaatcgaagattgaggactactttccagaattt
gctcgctacactactcctgaggacgctactcccgagcccggagaggacccacgcgtgacc
cgggccaagtactttatccgcgacgaatttctgagaatcagcactgctagtggagatggg
cgccactactgctacccccacttcacttgcgccgtggacaccgagaacatccgccgtgtg
ttcaatgactgccgtgacatcattcagcgcatgcacctccgtcagtatgagctgctctaa

DBGET integrated database retrieval system