KEGG   Enhydra lutris kenyoni (northern sea otter): 111141432
Entry
111141432         CDS       T05871                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04062  Chemokine signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Module
elk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111141432
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111141432
   04310 Wnt signaling pathway
    111141432
   04371 Apelin signaling pathway
    111141432
   04020 Calcium signaling pathway
    111141432
   04070 Phosphatidylinositol signaling system
    111141432
   04072 Phospholipase D signaling pathway
    111141432
   04071 Sphingolipid signaling pathway
    111141432
   04022 cGMP-PKG signaling pathway
    111141432
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111141432
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111141432
   04621 NOD-like receptor signaling pathway
    111141432
   04062 Chemokine signaling pathway
    111141432
  09152 Endocrine system
   04911 Insulin secretion
    111141432
   04922 Glucagon signaling pathway
    111141432
   04929 GnRH secretion
    111141432
   04912 GnRH signaling pathway
    111141432
   04915 Estrogen signaling pathway
    111141432
   04921 Oxytocin signaling pathway
    111141432
   04926 Relaxin signaling pathway
    111141432
   04935 Growth hormone synthesis, secretion and action
    111141432
   04918 Thyroid hormone synthesis
    111141432
   04919 Thyroid hormone signaling pathway
    111141432
   04928 Parathyroid hormone synthesis, secretion and action
    111141432
   04916 Melanogenesis
    111141432
   04924 Renin secretion
    111141432
   04925 Aldosterone synthesis and secretion
    111141432
   04927 Cortisol synthesis and secretion
    111141432
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111141432
   04270 Vascular smooth muscle contraction
    111141432
  09154 Digestive system
   04970 Salivary secretion
    111141432
   04971 Gastric acid secretion
    111141432
   04972 Pancreatic secretion
    111141432
   04973 Carbohydrate digestion and absorption
    111141432
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111141432
  09156 Nervous system
   04724 Glutamatergic synapse
    111141432
   04725 Cholinergic synapse
    111141432
   04728 Dopaminergic synapse
    111141432
   04726 Serotonergic synapse
    111141432
   04720 Long-term potentiation
    111141432
   04730 Long-term depression
    111141432
   04723 Retrograde endocannabinoid signaling
    111141432
  09157 Sensory system
   04742 Taste transduction
    111141432
   04750 Inflammatory mediator regulation of TRP channels
    111141432
  09159 Environmental adaptation
   04713 Circadian entrainment
    111141432
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141432
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111141432
   05016 Huntington disease
    111141432
   05017 Spinocerebellar ataxia
    111141432
   05022 Pathways of neurodegeneration - multiple diseases
    111141432
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111141432
   04934 Cushing syndrome
    111141432
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111141432
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141432
   05142 Chagas disease
    111141432
   05143 African trypanosomiasis
    111141432
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111141432
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111141432
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111141432
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111141432
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 111141432
NCBI-ProteinID: XP_022349685
UniProt: A0A2Y9IUR0
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGIKFVKWDDDSAIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPVKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSDPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQTDLEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPSLASEPGKMNHRPPSS
DELEGDNPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcatcaaattcgtcaagtgggatgatgactctgctattgtcactcca
attattttgaggactgaccctcagggatttttcttttactggaccgatcaaaataaggag
acggagctgttagatctcagccttgtcaaggatgccagatgtgggaagcatgccaaagct
cccaaggaccccaagttacgtgaacttttggatgtggggaacatcgggcgcctggagcat
cgtatgataaccgtggtgtatgggcctgacttggttaacatctcccatttgaatctcgtg
gctttccaagaagaagtggcgaaggagtggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaatatgtcaagagacgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttctcagca
gaccggaagcgagttgaaactgctttagaggcctgtagtcttccatcttcaaggaacgat
tcaatacctcaagaggatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatacctt
actgttgatcagatgatggactttatcaaccttaagcagcgagatccccggctaaatgaa
atactttacccacctttaaagcaagaacaagtccaagtattgattgagaagtatgaaccc
aacaatagtctcgccaagaaaggacagatatcagtggatggctttatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagatatgtctcag
cccctctctcactatttcatcaattcctcacacaacacctacctcacagctggccagttg
gctggaaactcctctgtcgagatgtatcgccaagtgcttctgtctggttgtcgctgtgtg
gagttggactgctggaagggacggactgctgaagaggaaccagtcatcacccatgggttc
accatgacaaccgaaatatccttcaaggaagtgatagaagcaattgctgagtgtgcattt
aagacgtcaccttttccaattctgctttcatttgagaaccacgtagattccccaaagcag
caagccaagatggcggagtattgccgactgatctttggagatgctcttctcatggaacca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttggtgaaaaataagaagaaatcacacaagtcgtcggaaggaagtggcaaaaag
aagctctcggaacaagcgtccaacacgtacagtgactcctccagcatgttcgagccctcg
tctcccggagccggggaagctgacactgagagtgacgacgacgacgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgccgggagtgaggccatggccaccgaagagatg
tctaacctggtgaactacattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaatagaagtttcgaaatgtcttccttcgtggaaaccaaaggccttgagcaactgacg
aagtctcccgtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacccgtgtggattcatcgaactacatgcctcagctcttctggaatgcaggttgccaa
atggttgcccttaattttcaaactgtggacctcgctatgcaaataaatatggggatgtac
gaatacaatgggaaaagtggctacagattaaaaccagagttcatgaggagacctgacaag
cattttgatccattcaccgaaggcatcgtggatgggatagtggccaacactttatctgtt
aagattatttcaggtcagtttctttccgataagaaagtcgggacttacgtagaagtggat
atgtttggtttgcctgtggacacaaggaggaaggcatttaagaccaaaacatcacaagga
aatgctgtaaatcctgtctgggaagaagagcccattgtgttcaaaaaggtggtccttcct
tctctggcctgtttgaggatagcagtttatgaagaaggaggtaaattcattggtcaccgg
atcttgcccgtacaagcaattcggccaggctatcactacatctgcctgaggaatgaaagg
aaccagcctctgatgctcccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaatacgatatgtgaatctcatg
gagcaaagagctaaacagttagctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggggaaacaccatcagaagctccaagtgaagccaggacaactccagca
gaaaacggagtgaatcacactacatccttggcacccaaaccaccatcccaggctctccac
agccaaccggctccaggttctgtaaaggcacctgtgaaaacagaagaccttattcagagt
gtcctaacagaagtggaagcccagaccatcgaagagctaaagcagcagaaatcctttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaaaagacaccacaagaaa
accactgatcttatcaaagaacacactacaaaatataatgagattcagaacgactacttg
agaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcagatccc
agcagtcctgaccatggttcatcaacgattgaacaagatcttgctgccctagatgctgaa
atgacccaaaagttaatagacttgaaagacaaacaacagcaacagctgcttaatcttcga
caagagcagtattatagtgaaaaatatcagaagcgagaacatattaaactgcttattcaa
aaattgacggatgttgctgaagaatgtcagaataatcagctgaagaagctcaaagaaatc
tgtgagaaagagaagaaggagttaaagaagaagatggacaaaaaaaggcaggagaagata
acagaagctaaatccaaagacaaaagtcaaatggaagaggaaaagacagagatgatccgg
tcatacatccaagaggtggtgcagtacatcaagaggttagaagaggcccaaagtaaacgg
caagaaaaacttgtagagaaacacaaggagatacgtcaacagatcctggacgaaaagccc
aagctgcagacagacctggagcaagaataccaagacaagttcaaaagactgcccctggag
atcttggagttcgtgcaggaagccatgaaagggaagatcagtgaagacagcaaccacagc
tctgcccctccctccctggcctcagagcctggaaaaatgaaccacaggcctccctccagt
gacgagctggaaggagacaacccaggaaaagagtttgatactcctctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111141620
Entry
111141620         CDS       T05871                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04062  Chemokine signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Module
elk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111141620
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111141620
   04310 Wnt signaling pathway
    111141620
   04371 Apelin signaling pathway
    111141620
   04020 Calcium signaling pathway
    111141620
   04070 Phosphatidylinositol signaling system
    111141620
   04072 Phospholipase D signaling pathway
    111141620
   04071 Sphingolipid signaling pathway
    111141620
   04022 cGMP-PKG signaling pathway
    111141620
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111141620
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111141620
   04621 NOD-like receptor signaling pathway
    111141620
   04062 Chemokine signaling pathway
    111141620
  09152 Endocrine system
   04911 Insulin secretion
    111141620
   04922 Glucagon signaling pathway
    111141620
   04929 GnRH secretion
    111141620
   04912 GnRH signaling pathway
    111141620
   04915 Estrogen signaling pathway
    111141620
   04921 Oxytocin signaling pathway
    111141620
   04926 Relaxin signaling pathway
    111141620
   04935 Growth hormone synthesis, secretion and action
    111141620
   04918 Thyroid hormone synthesis
    111141620
   04919 Thyroid hormone signaling pathway
    111141620
   04928 Parathyroid hormone synthesis, secretion and action
    111141620
   04916 Melanogenesis
    111141620
   04924 Renin secretion
    111141620
   04925 Aldosterone synthesis and secretion
    111141620
   04927 Cortisol synthesis and secretion
    111141620
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111141620
   04270 Vascular smooth muscle contraction
    111141620
  09154 Digestive system
   04970 Salivary secretion
    111141620
   04971 Gastric acid secretion
    111141620
   04972 Pancreatic secretion
    111141620
   04973 Carbohydrate digestion and absorption
    111141620
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111141620
  09156 Nervous system
   04724 Glutamatergic synapse
    111141620
   04725 Cholinergic synapse
    111141620
   04728 Dopaminergic synapse
    111141620
   04726 Serotonergic synapse
    111141620
   04720 Long-term potentiation
    111141620
   04730 Long-term depression
    111141620
   04723 Retrograde endocannabinoid signaling
    111141620
  09157 Sensory system
   04742 Taste transduction
    111141620
   04750 Inflammatory mediator regulation of TRP channels
    111141620
  09159 Environmental adaptation
   04713 Circadian entrainment
    111141620
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141620
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111141620
   05016 Huntington disease
    111141620
   05017 Spinocerebellar ataxia
    111141620
   05022 Pathways of neurodegeneration - multiple diseases
    111141620
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111141620
   04934 Cushing syndrome
    111141620
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111141620
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111141620
   05142 Chagas disease
    111141620
   05143 African trypanosomiasis
    111141620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111141620
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111141620
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111141620
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111141620
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 111141620
NCBI-ProteinID: XP_022350031
UniProt: A0A2Y9IP94
LinkDB
Position
Unknown
AA seq 1194 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVSILEDDNEEEIESADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNR
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKMSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEVGSRDGPQASNSSVKLQNSN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gccgtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggaggagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtattcgattgggagccacgcccaaggatcccaaaatcctg
gccgctctcgaagctgttggaaagtcagagaatgatctggaagggcggatagtttgtgtt
tgcagtggcacagatctggtgaacatcagtttcacatacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggactgagatcgatcatacacaacttcagggccaacaat
gtcagtccaatgacctgcctcaagaaacactggatgaaattggcgtttatgaccaacacg
aatggtaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaaa
gtgatctttcaagcactcaaggaattaggtcttcccagtggaaagaacgacgaaattgag
cctgcggcatttacttatgaaaagttctatgaactgacacaaaaaatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcagcgagaccctcgactgaatgaaattttattc
ccattttacgatgctaaaagggcaatgcagatcatcgagatgtatgagcccgatgaagat
ttgaagaaaaaaggcctcatatcaagcgatgggttttgcagatacctgatgtcagatgaa
aatgccccagtcttcctggatcgtttagaactttaccaagaaatggaccatcctctggcc
cactacttcatcagttcttcccataacacctatctcacgggccgacagtttggtgggaaa
tcttcagtagaaatgtacagacaggttctcctggctggttgcagatgcgttgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccgataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgttattcaagccatcaaggaaaccgcatttgtcacatcc
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcagcagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcccttaccatcccccaatgacctcaaaagaaaaatactcatc
aaaaataagcggctgaaacctgaggttgaaaaaaaacagctcgaggctttgaaaagcatg
atggaagctggagaatctgctgccccggttagtatcctagaggatgataatgaagaggaa
atagaaagtgctgaccaagaggaggaagctcaccccgaatacaaatttggaaacgaactt
tctgctgatgacttgggccacaaggaggctgttgcaaatagtgtcaagaagggcctggtg
accgtggaagatgaacaggcatggatggcgtcttataaatatgtaggtgctaccactaac
atccatccgtatttgtctacaatgatcaactatgcacaacccgtaaagtttcaaggtttc
catgtggctgaagagcgcaatattcattataacatgtcttcttttaatgagtccgtcggc
ctgggctacttgaagacgcacgccattgaatttgtgaattataacaaacggcaaatgagc
cgcatttaccccaagggaggccgggtcgattccagtaattacatgcctcagattttctgg
aatgctggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcctgcgggtacctcctcaaaccagatttcatg
agacggcccgatcgaacattcgatcccttctctgaaactcctgtcgatggcgttattgcg
gccacttgctcagtccaggtcatatcaggtcagtttttatcagataagaaaattggtaca
tacgtagaagtggatatgtatgggttgcccaccgacaccatacgtaaggaattccgaact
cgcatggtaatgaacaacggactcaatccagtttacaatgaagaatcatttgtgttccgg
aaggtaatcctccctgacctggcagtcttgagaatagcagtgtatgacgacaacaacagg
ctcataggccagaggatccttcctctggatggcctccaagcaggttatcgacacatttcc
cttcgaaacgagggaaataaaccattatcactgccaaccattttctgcaatattgttctt
aaaacatatgtgcctgatggatttggagatatcgtagatgctttatcagatccaaagaaa
tttctttccattacggaaaagagagcagaccaaatgagagctatgggcattgaaactagt
gacatagcagacgtgcccagtgatacttctaagaacgacaagaaaggaaaagccaacact
gccaaagcaaacgtgaccccacagagcagctctgagctcagaccaaccaccacggcggcc
ctggggtctggtgtggaagcgaagaaaggtatcgaacttatccctcaagtgaggatagaa
gatttgaagcagatgaaggcttacctgaagcacttaaagaaacaacagaaggagctaaat
tctttaaagaagaagcacgcaaaggagcacagcacaatgcagaagttgcactgcacacaa
gttgacaaaatcgtggcacagtacgacaaagagaagtcgacgcatgagaaaatcctagag
aaagcgatgaagaagaaagggggaagtaattgtctcgaaatgaaaaaagaaactgaaatt
aaaattcagacactgacatcagatcacaaatctaaggtcaaagagatagtggcccagcac
acgaaggagtggtcagaaatgatcaacacccacagtgctgaggagcaagaaatccgggac
ctacacctcagccagcagtgtgagctcctgagaaaactactgatcaatgcccatgagcag
caaacccagcagctgaaaatgtcccatgacagggaaagcaaggaaatgcgagcacaccag
gctaagatttctatggaaaacagcaaagccatcagccaagataaatctatcaagaacaaa
gcagaacgggaaaggcgagtcagggagttaaatagcagcaacaccaaaaagtttctggaa
gaaagaaagagacttgcaatgaaacagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacacctcgagttcctagagaaacagaatgagcagctattgaaatcctgccatgca
gtgtcccaaacacaaggcgaaggagatgcagcagatggtgaagttggaagccgagatgga
ccgcaggccagcaacagtagtgtgaaactccaaaattcaaactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111150005
Entry
111150005         CDS       T05871                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04062  Chemokine signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Module
elk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111150005
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111150005
   04310 Wnt signaling pathway
    111150005
   04371 Apelin signaling pathway
    111150005
   04020 Calcium signaling pathway
    111150005
   04070 Phosphatidylinositol signaling system
    111150005
   04072 Phospholipase D signaling pathway
    111150005
   04071 Sphingolipid signaling pathway
    111150005
   04022 cGMP-PKG signaling pathway
    111150005
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111150005
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111150005
   04621 NOD-like receptor signaling pathway
    111150005
   04062 Chemokine signaling pathway
    111150005
  09152 Endocrine system
   04911 Insulin secretion
    111150005
   04922 Glucagon signaling pathway
    111150005
   04929 GnRH secretion
    111150005
   04912 GnRH signaling pathway
    111150005
   04915 Estrogen signaling pathway
    111150005
   04921 Oxytocin signaling pathway
    111150005
   04926 Relaxin signaling pathway
    111150005
   04935 Growth hormone synthesis, secretion and action
    111150005
   04918 Thyroid hormone synthesis
    111150005
   04919 Thyroid hormone signaling pathway
    111150005
   04928 Parathyroid hormone synthesis, secretion and action
    111150005
   04916 Melanogenesis
    111150005
   04924 Renin secretion
    111150005
   04925 Aldosterone synthesis and secretion
    111150005
   04927 Cortisol synthesis and secretion
    111150005
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111150005
   04270 Vascular smooth muscle contraction
    111150005
  09154 Digestive system
   04970 Salivary secretion
    111150005
   04971 Gastric acid secretion
    111150005
   04972 Pancreatic secretion
    111150005
   04973 Carbohydrate digestion and absorption
    111150005
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111150005
  09156 Nervous system
   04724 Glutamatergic synapse
    111150005
   04725 Cholinergic synapse
    111150005
   04728 Dopaminergic synapse
    111150005
   04726 Serotonergic synapse
    111150005
   04720 Long-term potentiation
    111150005
   04730 Long-term depression
    111150005
   04723 Retrograde endocannabinoid signaling
    111150005
  09157 Sensory system
   04742 Taste transduction
    111150005
   04750 Inflammatory mediator regulation of TRP channels
    111150005
  09159 Environmental adaptation
   04713 Circadian entrainment
    111150005
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111150005
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111150005
   05016 Huntington disease
    111150005
   05017 Spinocerebellar ataxia
    111150005
   05022 Pathways of neurodegeneration - multiple diseases
    111150005
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111150005
   04934 Cushing syndrome
    111150005
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111150005
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111150005
   05142 Chagas disease
    111150005
   05143 African trypanosomiasis
    111150005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111150005
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111150005
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111150005
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111150005
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 111150005
NCBI-ProteinID: XP_022363022
UniProt: A0A2Y9JPU3
LinkDB
Position
Unknown
AA seq 1231 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWTEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SVRKRPLEQSNSALSESSAATTEPSSPQLGSPSSDSCPGLSNGEEVALEKPSLEPRKSLG
EDGLQRGADALGSADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASPETCQETPSQQ
LGSQLTPNPTPSPLDTSPRRPPGPATSPTSTSLSSPGQRDDLIASLLSEVAPASLDELRG
HKALVKLRGRQERELRELRKKHQRKAVALTRRLLGGLAQARAEGRCRPRPGVLGGENEKE
EEEEAKRYQEFQKRQVQSLLELREAQADTEAERQLEHLRQAQQRLREIVLEAHTTQIKRL
KEMNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQ
KQRHERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRASLPQEIHRSLLGETPEELGDGH
LVACASNGHAPGSSGHLSGADSESQEENTKL
NT seq 3696 nt   +upstreamnt  +downstreamnt
atggccggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtagag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtaaccctgcgtgtggactccaatggcttttttctgtattggactggacccaacatggag
gtggacacactggacatcagttccatcagggacacgcggacgggtcgctatgcccgcctg
cccaaggaccccaagatccgggaggtgctgggctttgggggccctgatgcccggctggag
gagaagttgatgacagtggtggctgggccagacccggtgaatacgacgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggaccgaggagctgtttaagctggctatg
aacatcctggctcagaacgcctcccggaacacgttcctgcgaaaagcatacacaaagctg
aagctgcaggtgaaccaggacggacggattccggtgaagaatatcctgaagatgttttca
gcagataagaagcgggtagagactgcactggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcccgacgagttttccttggagatcttcgagcggttcctgaataagttg
tgtctgcggccagacattgacaagatcctgctggagataggcgccaagggcaagccttac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgggacccgaggctcaac
gaggtgctgtacccacccctgcggccatcccaggcccggctgctcatcgagaagtatgag
cccaaccagcagttcctagagcgtgaccagatgtccatggagggcttcagccgctacctg
ggcggtgaggagaatggcatcctgcccctggaggccctggatctcagcgcggacatgacc
cagcctctgagtgcctacttcatcaactcctcacacaacacctatctcacagcggggcag
ctggccgggacctcgtcggtggagatgtaccggcaggcgctgctgtggggctgccgctgc
gtggagctggacgtgtggaaaggccggccgcccgaggaggagcccttcatcacccacggc
ttcaccatgaccacggaggtgccgctgcgggacgtgctcgaggccatcgcggagactgcc
ttcaagacctcgccctaccccgtcatcctctcctttgagaaccacgtggactcagcaaag
cagcaggccaagatggccgagtactgccggtccatctttggggacgcgctgctcatcgac
ccgctggacaagtacccgctggccccaggcgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcgacaccagcccagcaccggtgtccccaacagc
tctgtgcgcaagcggcccctggaacagagcaactcggccctgagtgagagctcggctgcc
accactgagccctcctcccctcagctcgggtcccccagctctgacagctgcccaggcctg
agcaacggggaagaagtagccctggagaagcccagcctggagcctcgcaagtcgctgggt
gaggacgggctacagcggggcgctgatgctcttggatctgcagaccgtgaggatgaggag
gaggatgaggaagaggaggaacagacagatcctaaaaagccgaccacagatgagggcact
gccagcagtgaggtcaatgccaccgaggaaatgtccacactcgtcaactacatcgagcct
gtcaagttcaagtcctttgaggctgctcgaaaaaggaacaaatgcttcgagatgtcatct
ttcgtggaaaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatac
aacaagcagcagctcagccgcatctaccccaagggtacccgcgtggactcatccaactac
atgccccagctcttctggaatgtcggctgccagcttgtcgcgctcaacttccagaccctg
gacgtggcgatgcagctaaacgcaggcgtgtttgagtacaacgggcgcagcggctacctg
ctcaagcccgagttcatgcggcggccggacaagtccttcgatcccttcaccgaagtcatc
gtggacggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctgtcc
gacaggaaggtgggcatctatgtggaagtggacatgttcggcctccccgtggatacgcgg
cgcaaataccgcactcggacttctcaggggaattccttcaatcccgtgtgggacgaggag
ccctttgacttccccaaggtggtgctgcccacgttggcttccctgcgcatcgcggccttt
gaggagggcggcaagtttgtggggcatcgaatcctgcctgtctcggccatccgctcaggg
taccactacatctgtctgcggaacgaggccaaccagccgctctgtctgccggccctgctc
atttacactgaagcctctgactacattcctgacgaccaccaggactacgcagaggccctt
atcaaccccatcaagcatgtcagcctgatggaccagagggccaagcagctggccgccctc
attggggagagcgaggctcaggccagcccagagacctgccaagagactccgtctcagcag
ctggggtcccagctgaccccaaaccccacacccagcccgctggacacctccccacgccgg
cccccaggccctgccacgtcccctaccagcacctcactcagcagcccaggccagcgggat
gacctcatcgccagcctcctctcagaggtggccccggcctcgctggacgagctccgaggc
cacaaggcgttggtgaagctccggggccggcaggagcgagagctgcgggagctgcgcaag
aagcaccagcgcaaggccgtcgccctcacacgccggctgctcggcggcctggcccaggcc
cgggcggagggcaggtgccgcccacggccgggtgtcctaggtggggagaacgagaaggag
gaggaggaagaggcgaagcggtatcaggaattccagaagagacaggtgcagagtctcctg
gagctgagggaggcccaggccgacacagaggctgagcggcagctggagcacctgagacag
gctcagcagcggctcagggagattgtcctggaagctcacacaactcagatcaagaggctg
aaggagatgaacgagagggagaagaaggaactgcagaagattctggacaggaagcgtcat
aacagtatctcagaggccaagacaagggagaaacataagaaggaggcggaactgacagag
attaaccgccggcacatcaccgagtcggtcaactccatccgtcggctggaggaggcccag
aagcagcggcatgagcgccttgtggctgggcagcagcaggtcctacagcagctggcagaa
gaggagcccaagctgctagcccagctggcccaggagtgtcaggagcagcgggcgagtctg
ccccaggagatccaccggagcctgctgggcgagacgccggaggagctgggggacgggcat
ctggtggcctgtgccagtaatggtcacgcacctggaagcagcgggcacctgtccggcgct
gactcggagagccaagaggagaatacgaagctctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162302
Entry
111162302         CDS       T05871                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04062  Chemokine signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Module
elk_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111162302
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111162302
   04310 Wnt signaling pathway
    111162302
   04371 Apelin signaling pathway
    111162302
   04020 Calcium signaling pathway
    111162302
   04070 Phosphatidylinositol signaling system
    111162302
   04072 Phospholipase D signaling pathway
    111162302
   04071 Sphingolipid signaling pathway
    111162302
   04022 cGMP-PKG signaling pathway
    111162302
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111162302
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111162302
   04621 NOD-like receptor signaling pathway
    111162302
   04062 Chemokine signaling pathway
    111162302
  09152 Endocrine system
   04911 Insulin secretion
    111162302
   04922 Glucagon signaling pathway
    111162302
   04929 GnRH secretion
    111162302
   04912 GnRH signaling pathway
    111162302
   04915 Estrogen signaling pathway
    111162302
   04921 Oxytocin signaling pathway
    111162302
   04926 Relaxin signaling pathway
    111162302
   04935 Growth hormone synthesis, secretion and action
    111162302
   04918 Thyroid hormone synthesis
    111162302
   04919 Thyroid hormone signaling pathway
    111162302
   04928 Parathyroid hormone synthesis, secretion and action
    111162302
   04916 Melanogenesis
    111162302
   04924 Renin secretion
    111162302
   04925 Aldosterone synthesis and secretion
    111162302
   04927 Cortisol synthesis and secretion
    111162302
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111162302
   04270 Vascular smooth muscle contraction
    111162302
  09154 Digestive system
   04970 Salivary secretion
    111162302
   04971 Gastric acid secretion
    111162302
   04972 Pancreatic secretion
    111162302
   04973 Carbohydrate digestion and absorption
    111162302
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111162302
  09156 Nervous system
   04724 Glutamatergic synapse
    111162302
   04725 Cholinergic synapse
    111162302
   04728 Dopaminergic synapse
    111162302
   04726 Serotonergic synapse
    111162302
   04720 Long-term potentiation
    111162302
   04730 Long-term depression
    111162302
   04723 Retrograde endocannabinoid signaling
    111162302
  09157 Sensory system
   04742 Taste transduction
    111162302
   04750 Inflammatory mediator regulation of TRP channels
    111162302
  09159 Environmental adaptation
   04713 Circadian entrainment
    111162302
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162302
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111162302
   05016 Huntington disease
    111162302
   05017 Spinocerebellar ataxia
    111162302
   05022 Pathways of neurodegeneration - multiple diseases
    111162302
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111162302
   04934 Cushing syndrome
    111162302
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111162302
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111162302
   05142 Chagas disease
    111162302
   05143 African trypanosomiasis
    111162302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111162302
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     111162302
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    111162302
 Endocytosis
  Macropinocytosis
   Phospholipase C
    111162302
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Gp58 Lectin_N AAA_13
Other DBs
NCBI-GeneID: 111162302
NCBI-ProteinID: XP_022382340
UniProt: A0A2Y9LKU2
LinkDB
Position
Unknown
AA seq 1220 aa
MSLLNPVLLSPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKSWAEDVLALAKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPLARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKLPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRMTFGEMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSVPATPSKEPGGG
AENSCPPSASVGEDPVWAGEDGAQPEEEEVEEEEEESGNLDEEELKKMQSDEGTAGLEVT
AYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMS
RIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFM
RRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSDRSVRTYVEVELFGLPGDPKRRYRTK
LSPSANSINPVWKEEPFVFEKILMPELASLRVAVLEEGNKFLGHRIIPINALNSGYHHLC
LHSESNLPLTMPALFVFLELKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAMEGLP
EKPFPLGSPVVRPVNGALAPTSNGSAAHPVALAAAGARAKEEAMKEATEPQTASPEELRE
LKGVVKLQRRHEKELRDLERRGARRWEELLQRGAAELAGLGPPGAGGCGGRRLGPGKGSR
KKRTLQCEEAAGAAPGEGREGPEGADARARELQDRLELELLQQGEERYECILKRKAQHVA
EQIAKMMELAREKQAAELKTLKETLETDTKEMKKKLEAKRLERIQAMIKVTPDKMAQERL
KREINNSHIQEVVQVIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQQEVLAEYEVRM
KGLEAEVKESVKACLRNCLPSEAKDKPERPYEAFRELCDQDPLTAKFPDTEPVQAPWGQL
LPVSWAEVPSLASCLWGMGG
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgtctctcctcaaccctgtcctgctgtcccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaactacaatagcctccccagttatcctccgtgtg
gatcccaagggttactacttatattggacatatcagagtaaggagatggagtttctggat
atcaccagcatcagggatacccgctttgggaagtttgccaagatacccaagagccagaag
ctccgggacgtcttcaacatggacttccccgacaacaactttctcctcaagacactcact
gtggtgtctggccctgacatggtagacctcaccttccacaacttcgtctcctataaggag
aatgtgggcaagagctgggccgaagatgtgctggcccttgccaagcacccactgacggcc
aatgcctcccgtagcaccttcttggacaaaatcctcgtgaagctcaagatgcagctcaat
ccggaagggaagattcctgtgaaaaattttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgccctcagtgcttgccacctcccaaaaggcaagaacgatgccatcaatcct
gaggacttcccagaatccgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcctaccatgccaaggccaaaccttacatgaccaaagaacac
ctgaccaagttcatcaaccagaaacagagggacccccgtctcaactctctgctgtttccg
ctggcgcggcctgaccaggtgcagggcctcattgacaagtatgagcccagtggcatcaac
gtgcagaggggccagctctcccccgagggcatggtgtggtttctctgcgggcctgagaac
agcgtgctggcccaggacaagctgcttctccaccaggacatgacgcagcccctcaaccat
tacttcatcaactcctcacacaacacttacctgacagccggccagttctctggcctgtcg
tcggctgagatgtaccgccaggtgctgctggccggctgccgctgcgtggagctggactgc
tggaagggcaagctccctgatgaggagcccattatcacccatggcttcaccatgaccaca
gacatctacttcaaggaagcaattgaagccattgcagaaagtgcctttaagacctccccc
tatcctgtcatcctgtcatttgaaaaccatgtggactcaccccgccaacaggccaagatg
gctgaatactgccggatgacgtttggggagatgctgctcacagagcccttggaaaagttc
ccattgaaaccaggcatccccctgcccagccctgaggatctccgaggcaagatcctcatc
aagaacaaaaagaaccagttttctgtcccagcaacccccagcaaggagccgggtgggggt
gctgagaacagctgcccacccagtgcctctgtgggagaggacccagtgtgggctggtgag
gacggggcacagccggaggaggaagaggtggaagaggaggaggaggagtcgggaaacttg
gatgaggaggagctcaagaagatgcagtcggatgagggcacagcaggcctagaggtgaca
gcttacgaggagatgtccagcctagtgaattacatccagcccaccaagttcatctccttt
gagttctctgcccagaaaaacagaagctatgtcatctcgtccttcacagagctcaaggcc
tatgacctgctctccaaggcctcagtgcagttcgtggactacaacaagcgccagatgagc
cgcatttacccgaagggcacacgcatggactcctccaactatatgccccagatgttctgg
aacgccggttgccagatggtggccctcaacttccagacaatggacctgcccatgcagcag
aacatggcgttgtttgagttcaacgggcagagtggctacctcctcaagcatgagttcatg
cggcggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtggcc
accaccctttccatcacggtcatctctggacagttcctgtcggatcgcagtgtgcgcaca
tatgtggaagtggaactctttggccttcccggggaccccaagaggcgctatcgcaccaag
ctgtcacccagtgccaactccatcaatcctgtctggaaggaggagccttttgtctttgag
aagatcttgatgcctgagctggcatccctcagggtggctgtactggaggaaggcaacaaa
tttcttggacaccgcatcatccccattaatgccctgaattctggctaccaccatctgtgc
ctgcatagcgaaagcaacttgccccttaccatgcccgccctttttgtcttcctggagttg
aaggactatgtacctgacacctgggcagatctcaccgtggctctggccaatcccatcaag
ttcttcagtgcccatgacaagaagtctgtgaagctcaaggaagccatggaaggtctgcct
gagaaacccttcccacttgggagtccagttgtccgcccagtcaacggggcgttggcccca
acgagcaatgggtctgcagcccaccctgtggctcttgcagcagctggggccagggccaag
gaggaggctatgaaagaagctacggagccccagaccgccagcccggaggagctgcgggag
ctgaagggcgtcgtgaagctgcagcggcggcacgagaaggagctgcgggacctggagcgg
cgcggcgcgcggcgctgggaggagctgctgcagaggggcgcagcggagctggccgggctg
gggccgccgggcgcgggggggtgcgggggccgccggctcggccccggcaagggctctcgc
aagaagaggaccctgcagtgcgaggaggccgccggggccgcgccgggcgagggccgcgag
ggccccgagggcgcggacgcgcgtgcacgcgagctgcaggaccggctggagctggagctg
ctgcagcagggtgaggagcggtacgagtgcatcctgaagcgcaaagcgcagcacgtggct
gagcaaatcgccaagatgatggagctggccagagagaagcaggcggcagagctgaagacc
ctcaaggagaccttggagactgacaccaaagagatgaaaaaaaagctggaggccaagagg
ctggagcggattcaggccatgatcaaagtcacccctgacaagatggctcaggaaagactg
aagagagagattaacaactctcacatccaggaggtggtgcaagtcattaagcagatgaca
gagaacctggagaagcaccaggagaagctggaggagaagcaggcagcctgcctggaacag
atccgggagatggaaaagcagttccagcaggaggtgctggcagagtacgaagtccggatg
aagggcctggaggctgaggtgaaggagtcagtgaaggcctgcctcaggaactgcttaccc
tctgaggccaaggacaagcctgagaggccttatgaggccttcagggagctgtgtgaccag
gacccactcacagcaaagttccctgatacagagcctgtccaagctccctggggacagctg
cttccagtatcctgggctgaggtcccttccctggcctcctgcctgtgggggatgggaggc
tga

DBGET integrated database retrieval system