KEGG   Enhydra lutris kenyoni (northern sea otter): 111141563
Entry
111141563         CDS       T05871                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04015  Rap1 signaling pathway
elk04062  Chemokine signaling pathway
elk04137  Mitophagy - animal
elk04144  Endocytosis
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04520  Adherens junction
elk04530  Tight junction
elk04540  Gap junction
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04625  C-type lectin receptor signaling pathway
elk04727  GABAergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05219  Bladder cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111141563
   04015 Rap1 signaling pathway
    111141563
   04370 VEGF signaling pathway
    111141563
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111141563
   04137 Mitophagy - animal
    111141563
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111141563
   04520 Adherens junction
    111141563
   04530 Tight junction
    111141563
   04540 Gap junction
    111141563
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111141563
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111141563
   04613 Neutrophil extracellular trap formation
    111141563
   04625 C-type lectin receptor signaling pathway
    111141563
   04062 Chemokine signaling pathway
    111141563
  09152 Endocrine system
   04912 GnRH signaling pathway
    111141563
   04915 Estrogen signaling pathway
    111141563
   04917 Prolactin signaling pathway
    111141563
   04921 Oxytocin signaling pathway
    111141563
   04926 Relaxin signaling pathway
    111141563
   04919 Thyroid hormone signaling pathway
    111141563
  09156 Nervous system
   04727 GABAergic synapse
    111141563
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111141563
  09158 Development and regeneration
   04360 Axon guidance
    111141563
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111141563
   05203 Viral carcinogenesis
    111141563
  09162 Cancer: specific types
   05219 Bladder cancer
    111141563
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111141563
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111141563
   05152 Tuberculosis
    111141563
   05100 Bacterial invasion of epithelial cells
    111141563
  09172 Infectious disease: viral
   05161 Hepatitis B
    111141563
   05168 Herpes simplex virus 1 infection
    111141563
   05163 Human cytomegalovirus infection
    111141563
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141563
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111141563
   01522 Endocrine resistance
    111141563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111141563
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111141563
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111141563
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  SRC family
   111141563
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111141563
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    111141563
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    111141563
  Macropinocytosis
   Kinases
    111141563
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 111141563
NCBI-ProteinID: XP_022349904
UniProt: A0A2Y9IRF1
LinkDB
Position
Unknown
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPTENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccaacggcgccgcagcctggagccc
actgagaacacccatggtggcggcgggggcgccttccccacctcacagacacccagcaag
ccagcctccgccgatggccaccgaggccccagtacggccttcccctccgcagctgctgag
cccaagctgttcgggggcttcaactcctcagacacagtcacctccccgcagagggcgggg
ccgctggctggtggagtgaccacctttgtggccctctatgactatgagtctcggacagag
accgacttgtccttcaagaaaggggagcggctccagattgtcaacaacacagagggtgac
tggtggctggcccactcgctcagcacgggacagacgggttacatccccagcaactatgtg
gcgccctccgactctatccaggctgaagagtggtactttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcggagaacccaagagggaccttcctggtgcgagaaagt
gagaccacgaaaggagcctactgcctctctgtgtctgatttcgacaatgccaagggcctc
aacgtgaagcactacaagatccgcaagctggatagcggtggcttctacatcacctcccgc
acccagttcaacagtctgcagcagctggtggcctactactccaaacatgctgacggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccccagactcagggcctggccaag
gatgcctgggagatccctcgggagtccctacggctggaggtcaagctgggccagggctgt
tttggagaggtgtggatggggacctggaacggaaccaccagagtggccatcaaaaccctg
aagccaggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaaactg
aggcacgagaagctcgtgcagctgtacgctgtggtgtccgaggagcccatctacatcgtt
acggagtacatgagcaaggggagcctgctggactttctcaagggggagacagggaagtac
ctgcggctgccgcagctggtggacatggctgctcagatcgcctcaggcatggcctatgtg
gaacggatgaactatgtccaccgggacctccgtgctgccaacatcttggttggagagaac
ctcgtgtgcaaagtggctgacttcggactggctcggctcatcgaggacaacgagtacaca
gccagacaaggtgccaaattccccatcaagtggacggctccagaagcggccctctacggc
cggttcaccatcaagtcagatgtgtggtcctttgggatcctgctgacggagctcacgaca
aagggacgggtgccctatcctggtatggtcaaccgagaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgcccgaatgtcccgagtccctgcacgacctcatgtgccag
tgttggcggaaagagccagaggaacggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggagagaacctatag

DBGET integrated database retrieval system