KEGG   Enhydra lutris kenyoni (northern sea otter): 111141582
Entry
111141582         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04921  Oxytocin signaling pathway
elk05135  Yersinia infection
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111141582
   04370 VEGF signaling pathway
    111141582
   04022 cGMP-PKG signaling pathway
    111141582
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111141582
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111141582
   04650 Natural killer cell mediated cytotoxicity
    111141582
   04660 T cell receptor signaling pathway
    111141582
   04658 Th1 and Th2 cell differentiation
    111141582
   04659 Th17 cell differentiation
    111141582
   04662 B cell receptor signaling pathway
    111141582
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111141582
  09158 Development and regeneration
   04360 Axon guidance
    111141582
   04380 Osteoclast differentiation
    111141582
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111141582
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111141582
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111141582
   05170 Human immunodeficiency virus 1 infection
    111141582
   05161 Hepatitis B
    111141582
   05163 Human cytomegalovirus infection
    111141582
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141582
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111141582
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111141582
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 111141582
NCBI-ProteinID: XP_022349955
UniProt: A0A2Y9IVG8
LinkDB
Position
Unknown
AA seq 912 aa
MDAPEQQPDPDGGDAPGHEPGGSPQDEFDFSILFDYEYLNPIEEEPNAHKVASPPSRLAY
PDEVLDYGLKPYSPLPSLPGEPPGGFGEPDRVGPQNFLSPAAKPAGASGLSPRIEITPSH
ELMQAGGPLRGRDTGLLGEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFI
SDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVP
RPASRSSSPGAKRRHSCAGALVASLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMD
ALNSLAADSPCGIPPKMWKTSPDPSPVSAAAPPKAGLPRHIYPAVEFLGPCEQEEGRSSA
PESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHY
ETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTV
TTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRL
VFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFT
AESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRASVKVNFYVINGK
RKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGNQPYYPQHPVVAESPSCLVAT
MAPCQQFRSGLPSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSV
LVHAGSQGQSSPLLHPSPANQQASPVIHYSPTNQPLRCGNHQEFQHILYCENFAPGPARP
GPPPASQGQRLSPGSYPTVIQQQSATSQRATKNGPPAGDHKEVLPTGVTIKQEQNLDQTY
LDDGHRYSSCTF
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggacgccccggagcagcagcccgaccccgacggcggggacgccccgggccacgagccc
gggggcagcccccaagacgagttcgacttctccatcctcttcgactatgagtatttgaat
cctatcgaagaagaaccgaatgcacataaggtcgccagcccaccctccagactcgcatac
cccgatgaagtcctggactatggcctcaagccatacagccccctccccagtctccctggc
gaaccccccggcggattcggagagccggatagggtagggccgcagaactttctgagcccg
gcggccaagccagcgggggcttcgggcctgagccctcggatcgagatcactccatctcac
gaactgatgcaggcaggggggcccctccgcggcagagacactggcctgctgggggagcag
ccgcccctggccggcgtggccgccagcccgcggttcaccctgcccgtgcccggcttcgag
ggctaccgcgagccgctttgcttgagccccgctagcagcggctcctctgcgagcttcatt
tccgacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgac
gacctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaata
atgtcacctcgaaccagcctcgctgaggacagctgcctgggccgccactcgcccgtgccc
cgtccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgtgccggggcc
ttggttgcctcgctgcccggagcctcaccccagcgctcccggagcccctcgccgcagccc
cgggacgacggcgcccccgctgggtacccccccacggctggctctgccgtcctcatggat
gccctgaacagcctcgccgcggactcgccttgtggcatcccccccaagatgtggaagacg
agccccgacccctcgccggtgtccgccgccgccccgcccaaggccggcctgccccgccac
atctacccggccgtggagttcctggggccctgcgagcaggaggaggggaggagctcggcc
cccgagtccatcttgctggtgccgcccacctggcccaagcagctggtgcctgccattccc
atctgcagcatcccagtgactgcatctctccctccgcttgagtggccgctctcccaccag
tcgggctcctatgagctgcggatagaggtgcagcccaagccacatcaccgtgcccactat
gagaccgaaggcagccgaggggctgtcaaagctccaactggtggccacccggttgttcag
ctccatggctacatggaaaacaagcccctgggacttcagatcttcattgggacagctgat
gagcggatccttaagccccacgccttctaccaggtgcaccgaatcacgggcaaaaccgtc
actaccaccagctatgagaagatcgtgggcaacaccaaagtcctggagattccactagag
ccaaaaaacaacatgagggcaaccattgattgcgcggggatcctgaagcttcggaacgcc
gacattgagctgcgcaaaggcgagacggacatcggcaggaagaacacacgggtgcgcctg
gtgttccgagtgcacattccagagtccagcggcaggatcgtttccctgcagacggcgtct
aaccccattgagtgctcccagcgatccgcgcacgagctacccatggtggagagacaggac
atcgacagctgcctggtttacgggggccaacagatgatcctcaccggacagaacttcaca
gccgagtccaaagtcgtgtttactgagaagaccacagatgggcagcaaatttgggagatg
gaagctacggtggataaagacaagagccagcccaacatgctttttgttgagatccccgag
tatcgaaacaagcacatccgtgcatcggtgaaggtgaacttctacgtcatcaatgggaaa
aggaaacgaagtcagcctcagcactttacctaccacccagtcccagccatcaagacggag
cccaccgatgagtacgaccccaccttgatctgcagccccgcgcacgggggcctgggcaac
cagccttactacccacagcacccagtggtggccgaatccccctcctgccttgtggccacc
atggcaccctgccagcaattccgctcggggctcccgtcccctgacgcccgctaccagcag
cagaacccggcggccgtcctctaccagcggagcaagagcctgagccccagcctgctgggc
taccagcagccggccctcatggccgcccccctgtccctggcggacgcccaccgctccgtg
ctggtgcacgccggctcccagggccagagctccccgctgctccacccttccccggccaac
cagcaggcctcgccggtgatccactactcacccaccaaccagccgctgcgctgcggcaac
caccaggagttccagcacatcctgtactgcgagaacttcgcgcccggccccgccaggcct
ggcccgccccccgccagtcaaggccagaggctgagcccgggctcctaccccacggtcatt
cagcagcagagcgccaccagccaaagagccaccaaaaacgggcccccggccggtgaccac
aaggaagtgttacccacaggagtgacaattaagcaggagcagaacttggaccagacctac
ttggatgacggtcacagatacagctcctgtaccttttga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152752
Entry
111152752         CDS       T05871                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04625  C-type lectin receptor signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04921  Oxytocin signaling pathway
elk05135  Yersinia infection
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111152752
   04310 Wnt signaling pathway
    111152752
   04022 cGMP-PKG signaling pathway
    111152752
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111152752
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111152752
   04660 T cell receptor signaling pathway
    111152752
   04658 Th1 and Th2 cell differentiation
    111152752
   04659 Th17 cell differentiation
    111152752
   04662 B cell receptor signaling pathway
    111152752
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111152752
  09158 Development and regeneration
   04360 Axon guidance
    111152752
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111152752
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111152752
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152752
   05170 Human immunodeficiency virus 1 infection
    111152752
   05161 Hepatitis B
    111152752
   05163 Human cytomegalovirus infection
    111152752
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111152752
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111152752
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 111152752
NCBI-ProteinID: XP_022367059
UniProt: A0A2Y9K5V7
LinkDB
Position
Unknown
AA seq 1107 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPSGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSFQLQGHKSYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEVDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATVLPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWNKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPALSV
PHPAQTQRPSSDTGHPRDSVLSTQRSLVCPIQQTYASMVTSSHLPQLQCRDENSGKEQHM
IPSSVMHQPFQVTSTPPVGSSYQPMQTNVVYNGPTCLPVNAASSQEYDPVLFPQDAPLPS
LINLGCQPPSSIPFHSSNSGPAGHLLAHTPHSVQTLPHLQSVGFHCSNTGQRSLSSPGAD
QVTGQPSPQLQPITYGPSHSGSATTASPGALHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSLATRMHSGQQSTQAQSTGQGGLSAPSSLICHNLCDPASFPPDEATVNIKPEPEEQE
PNFSTIGLQDITLDDVVMLSSLTQTSLCLTWNTSHQVQQRNGLTTVSSHVQLLSGESRGE
RDNWERHVSDFCFPRNRGEQAGSPSRP
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtcttcggcgag
gacggggcgccggcgccgccgccctcgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaagctatgaaggaacttgtgagattcctgaatctaaatacagcccatta
ggtggtcccaaaccttttgagtgcccaagcattcagattacatccatctctcctaactgt
catcaagaagtagatgctcatgaagatgacctacatataaatgacccagaaagggagtat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tcccttagtcctagtcctgccagcagtatatcttctaggagctggttctcagatgcatct
tcttgtgaatctctttcacacatttatgatgatgtggattcggagttgaatgaagctgct
gcccgatttactctcggatcccctctgacttctcctggtggctcgcccggaggttgccct
ggagaagagtcctggcatcaacaatatggacttggacactccttgtcacccaggcaatct
ccttgccactctcctagatcgagtgtcactgatgagaattggctgagccccaggccagct
tcagggccctcatcaaggcctacttccccctgtgggaaacgacggcactcgagtgctgag
gtttgttatgctggttccctttcaccccatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggcttaatgcttctgtccagggtggatcaggc
cttggccctgcactttttccatttcagtactgtgtagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttcagat
gaccaagggaatttatcaccatcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcaccctttacc
tggaacaaaccaaagcctggccataccccaatatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacagtgtgaactgaaaatagaagtgcaacctaaa
actcaccatcgagcccattatgaaactgaaggtagtcgaggagcagtaaaagcatctact
gggggacatcctgttgtaaagctcctgggctataatgaaaagccgataaatctacagatg
tttattggaacagcagatgaccgatatttacgaccccatgcattttaccaggtgcatcga
atcactgggaagactgttgctactgcaagtcaagagataataattgccagcacaaaggtt
ctggaaattccccttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaaa
aatactagagtacgactcgtgttccgtgtgcacatcccacagcccaatggaaaagtcctt
tctctgcagacagcttccatacctgttgagtgctctcagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcacaacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacacaaagaagaggttgacttgtcttcagttccagcattgtctgtg
cctcatcctgcccagacccagaggccttcctcagacacaggacacccacgtgacagtgta
ctgtcaacacagagaagcttggtttgtcccattcaacaaacatatgcatccatggtaact
tcatctcatctgccacagttgcagtgtagggatgaaaattctggtaaagaacagcatatg
ataccttcttcagtcatgcaccagccttttcaagtaacatcaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaacggaccaacttgtcttccagttaat
gctgcctctagtcaagaatatgatccggttttgtttccacaggatgcacctcttcctagt
ttaataaatcttggctgtcagccgccgtcatccataccttttcattcttcaaattcaggc
ccagcaggacatctcttagcccacacacctcattcggtgcagaccctgcctcacctgcag
tcagtgggattccattgttcaaatacaggacaaagatctctttcttctccaggggctgac
caggtcacaggccagccttcccctcagttacaacccattacatatggtccttcacattca
gggtctgctacaactgcttccccaggagccttgcatcccctggctagttcaccactttct
gggccaccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctctagccaccagaatgcattctggacagcagtcaactcaagcacaaagt
acaggccagggaggtctttctgcaccttcatccttaatctgtcacaatttgtgtgatcca
gcttcatttccacctgatgaagcaactgtgaacattaagcctgaacctgaagagcaagaa
cctaacttttcaacaattggtctgcaggacatcactttagatgatgtagtgatgttgtct
tctttgacacagaccagtttatgtctgacttggaacaccagccatcaggttcagcagaga
aatggcctaaccacagtgagctctcatgtccagctcctttctggagaatctagaggtgaa
cgagataattgggagagacatgtctcagatttctgtttcccaaggaacaggggtgagcag
gcaggctccccttccaggccctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154209
Entry
111154209         CDS       T05871                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04921  Oxytocin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05135  Yersinia infection
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111154209
   04310 Wnt signaling pathway
    111154209
   04024 cAMP signaling pathway
    111154209
   04022 cGMP-PKG signaling pathway
    111154209
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111154209
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154209
   04650 Natural killer cell mediated cytotoxicity
    111154209
   04660 T cell receptor signaling pathway
    111154209
   04658 Th1 and Th2 cell differentiation
    111154209
   04659 Th17 cell differentiation
    111154209
   04662 B cell receptor signaling pathway
    111154209
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111154209
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111154209
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154209
  09163 Immune disease
   05321 Inflammatory bowel disease
    111154209
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111154209
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111154209
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154209
   05170 Human immunodeficiency virus 1 infection
    111154209
   05161 Hepatitis B
    111154209
   05163 Human cytomegalovirus infection
    111154209
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111154209
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111154209
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 111154209
NCBI-ProteinID: XP_022369367
UniProt: A0A2Y9K6R0
LinkDB
Position
Unknown
AA seq 931 aa
MPSTSFPAPSKFPLGPPAAVCGSGETLGPAPPSGGTMKSAEEEHYSYASPGVRSTLLPSS
AQPSLPAPGHDLQTSAPGVPATAASQPPGYGGAVDSGPSSYFLSSGHARPNGAPALESPR
IEITSYMGLHHGNNQFFHDVEVDDVLPGSKRPPSTATLNLPNLEAYRDPSCLSPASSLSS
RSCNSEASSYESNFSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGVCGLLGSPRHSPS
TSPRTSVTEESWLGTRTSRPSSPCNKRKYGLNGQQLTSPHHSPTPSPRGSPRVSVTDDTW
LGNSTQYTSSAIVAAINALSTDGSLELDGVPVKARKTALDHCPSVALKVEPAGEDLGTTP
PTAEFLPEEFPSFQHVRKGAFCDQYLSVPQHPYQWARPRSPTAYGSPTLPALDWQLPSRS
GPYELRIEVQPKPHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTADD
RLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIVDCAGILKLRNSD
IELRKGETDIGRKNTRVRLVFRVHIPQPSGRMLSLQVASNPIECSQRSAQELPLVEKQSA
ASCPVLGGKKMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKMDRELCQPNSLVVEIPPF
RNQRITSPVQVSFYVCNGKRKRSQCQRFTYLPANAPAIKTEPADDYEPAPTCGPASQGPS
PFPKPCCSQPPASCPPPGFLPCPPRSTMLSAPPSTSPKLHDLSAATYSKGVAGPGLGLLR
PAGGVLAVEETPRLVGVHPGPPQPPPPALLRPQVSPQLSVGCPPGRRPAPCPDSPCSSPP
PGTQEPTCLQPCGPARPSATGHQLPQRPKAPRSESTAPRPLPPPEVREDGSRSLAPIPVM
VKREPQDLDQLYLDDVNEIIRNDLSSANIRS
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgccaagtaccagtttcccagccccttccaagtttccactcggccctccggctgcagtc
tgcgggagcggagaaactttggggcccgcgccgccctccggcggcaccatgaagtcggcg
gaggaagagcactatagttacgcctcccccggcgtccgctccactctgcttcccagctcg
gctcagccctcgctgcccgctccaggccacgacttgcagacctcggccccgggcgtgccg
gccaccgcagccagtcagcccccaggctatgggggcgcagtggacagcgggccctcgagc
tacttcctctcctccggccacgccagacccaacggggcccccgccctggagagcccccgc
atcgagatcacctcgtacatggggctgcaccacggcaacaaccagtttttccatgacgtg
gaggtggacgacgtccttcccggctccaagcggcccccctccacggccaccctgaatctg
cccaacctggaggcctaccgggacccctcgtgcctgagcccggccagcagcctgtcctcc
cgcagctgcaactccgaagcctcgtcctacgagtccaacttctcgtacccctacgcgtcc
ccacagacatccccgtggcagtcgccctgtgtgtcccccaagaccacggaccccgaggag
ggcttcccccgtggcctgggggtctgcggcttgctcggctccccccgacactcgccctcc
acctctccccgcacaagcgtcactgaggagagctggctggggacccgcacgtcccggccc
tcatcgccctgcaacaagaggaagtacggcctcaacggccagcagctgacctcgccgcac
cactcgcccacgccatccccgcgcggctcgccacgggtcagcgtcaccgacgacacgtgg
ctgggcaacagcacccagtacaccagctcggccatcgtggccgccatcaacgccctcagc
accgacggcagcctggagctggacggcgtccccgtgaaggcacgcaagaccgccctggac
cactgtccctcggtggcgctcaaggtggagccggccggcgaggacctggggaccacgccg
cccacggccgagttcctgcccgaggagttcccgtccttccagcacgtccggaagggtgcc
ttctgcgaccagtacctgtcggtgccgcagcacccgtaccagtgggcccggcctcggtcc
ccgacagcctacggcagcccgacgctcccggccctggactggcagctgccgtcgcgctcg
ggaccctacgagctgaggatcgaggtgcaacccaagccccaccacagagcccactacgag
acagaggggagccggggggccgtgaaggcgtcggccggaggacaccccagcgtgcagctt
cacggctacttggagaacgagccactcacactacagctgttcatcgggacggccgacgac
cgcctactgagaccccacgccttctaccaggtccaccggatcacgggcaagaccgtctcc
accaccagtcacgaagccattctctccaacaccaaagtcctggagatcccgctgttgccg
gagaacaacatgcgagccatcgtggactgtgctgggatcctgaagctcagaaactcagac
atcgagctgcggaaaggggagacggacatcgggaggaagaacaccagggtcaggctggtc
ttccgggtccacatcccgcagcccagcggccggatgctgtccctgcaagtggcctcgaac
cccatcgagtgctcccagcgctcggcccaggagctgcccctcgtggagaaacagagtgcg
gccagctgccctgtccttggtgggaagaagatggtcctgtccggccacaacttcctgcaa
gactccaaagtcatcttcgtggagaaagctccagacggtcaccacatctgggagatggag
gcgaagatggacagagagctgtgccagccgaactcgctggtggtcgagatcccgccgttc
cgcaaccagagaataaccagccccgtccaagtcagtttctacgtctgcaacgggaagaga
aagaggagtcagtgccagcgcttcacctaccttcccgcgaacgctccagccatcaagaca
gagcccgccgacgactacgagcctgccccgacctgcggaccagcgagccagggccccagc
cctttccctaagccctgctgcagccagccaccggcctcctgcccgccgcccggctttctg
ccctgccccccgaggagcaccatgctgtctgcgccccccagcaccagccccaagctccat
gacctctctgccgccacctacagcaagggcgtggccggcccgggcctcggacttctgcgg
ccggccggaggggtcctcgccgttgaggagacgccgagactcgtgggcgtgcaccccggg
cccccccagccgccgccccccgccctgctgcgaccccaggtgagtccccagctcagcgtc
ggctgtcccccaggccgccggccagctccgtgtcctgacagcccctgctcctcgccaccg
cccggtacccaagagccgacctgtttacagccctgcggccccgcccgcccgtccgcgaca
ggccaccagctgccccaacggccgaaggctccgaggagtgagtccacagccccccggcct
ctgccgccgcccgaggtgcgtgaggacggtagtcgtagtctggcccccattcccgtaatg
gtcaagcgagagcctcaggacttggaccagctgtacctggacgacgtaaatgaaataata
cggaacgatctctccagcgccaacatccgatcgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160328
Entry
111160328         CDS       T05871                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04625  C-type lectin receptor signaling pathway
elk04921  Oxytocin signaling pathway
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111160328
   04022 cGMP-PKG signaling pathway
    111160328
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111160328
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111160328
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111160328
  09158 Development and regeneration
   04360 Axon guidance
    111160328
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111160328
   05170 Human immunodeficiency virus 1 infection
    111160328
   05161 Hepatitis B
    111160328
   05163 Human cytomegalovirus infection
    111160328
   05167 Kaposi sarcoma-associated herpesvirus infection
    111160328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111160328
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    111160328
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 111160328
NCBI-ProteinID: XP_022379060
UniProt: A0A2Y9LC58
LinkDB
Position
Unknown
AA seq 900 aa
MGAASCEDEELEFKLVFGEEKETPPLGAGGSGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGASGGAGGGRVLECPSIRITS
ISPTPDPPATLEDNPDAWGDGSPRDYPPPEGFGGYRETGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWNLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLQSGAEE
TAAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQTFKFLPVIFKEEPLPDSSLRGFPSAPGPPFGTDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGGATGCARPPPV
SFLPRPFPDPYGGRGSPFPLGLPFPPPAPFRPPLPSSPPLEGPFPPQSGIPPTPTEGYNE
VGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPPA
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgggggccgcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggagacccccccgctgggcgcgggggggtcgggggaagaactggactcagaggacgcc
ccgccatgctgccgtctggccctgggggagccccctccctatggcgctgcccctattggc
attcccaggcctccaccccctcggcctggcatgcattcgccaccaccccgcccagccccc
tcacctggcacttgggagagccagcctgcccggtcagtgaggctggggggcccgggaggg
gcttccgggggtgctggaggaggccgtgttcttgaatgccccagcatccgcatcacttcc
atctctcccacccctgacccgccggccacgctggaggacaaccccgatgcctggggggac
ggctcccccagggattacccaccaccggaaggctttgggggctaccgagagacggggggc
cagggcgggggccccttcttcagccccagccctggcagcagcagcctgtcctcgtggagc
ttcttctccgacgcttcagacgaggcagccctgtacgcagcctgcgatgaggtggagtct
gagctgaatgaggcagcctcgcgctttggcctgggctcccccttgccctcgccccgggcc
tcccccaggccgtggacccccgacgatccctggaacctgtatggtccgagccctggaggc
cgggggccagaggatagctggctactcctcagcgctcctgggcccaccccagcctcccca
cggccggcctctccatgtggcaagcggcgctattccagctcgggaaccccatcttcggcc
tccccagctctgtcccgccgtggcagcctgggggaggagggccccgagccacctccacca
ccaccattgcctctggcccgggaccctggctcccctggcccttttgactacgtgggagcc
ccgccggcggagagcatcccgcagaagacccggcggacttccagcgagcaggcagtggcc
ctgcctcggtctgaggagcctgccccatgtaatgggaagctgcagtcaggggctgaggag
actgcggcgccccctggggggcctcgaaaggaggtggctggcatggactatctggcagtg
ccttcccccctggcttggtccaaggcccggattgggggacacagccccatcttcaggacc
tctgccctacccccactggactggccgctgcccagccagtatgagcagctggagctgagg
atcgaggtgcagcccagagcccaccaccgggcccactatgagactgagggcagccgagga
gctgtcaaagctgcccctggtggtcaccctgtagtcaagctcctgggctacagtgaaaag
ccactgaccctacagatgttcattggcactgcagatgaacggaacctgcggcctcatgcc
ttctatcaggtgcaccgtatcacgggcaagatggtggccacagctagctatgaagctgtc
gtcagtggtaccaaagtgttggagatgaccctgcttcctgagaacaacatggcagccaac
attgactgtgctggaatcctgaagctccggaattcagacatcgaactacggaagggggag
acggacatcgggcgcaagaacacgcgagtgcggctcgtattccgggtgcacgtgccccag
ggcagtgggaaggtcgtctcagtgcagacagcatcagtgcccattgagtgctcccagcgc
tcagcccaggagctgccccaggtagaggcctacagccccagtgcctgctccgtgagagga
ggagaggaactagtgctcactggctccaacttcctgccagactccaaggtggtgttcatc
gagaggggccctgatggaaagctgcagtgggaggaggaggccacagtaaaccggctgcag
agcaacgaggtgacgctgaccctgactgtccctgagtacagcaacaagcgggtgtcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaagcgcagtcctacccagact
ttcaagtttctgcctgtgatcttcaaggaggagcccttaccggactcatctctccgtggc
ttcccttcagcacctggtcccccctttggcactgacatggacttctcaccacccaggccc
ccttacccctcctatccccacgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacaccccctctgtacccccagacggggcccccaccatcctacagacct
ggcctgcggatgttccctgagactgggggtgccacaggttgtgcccgcccccctccagtc
tccttccttccccggcccttccccgacccctatggaggacggggctccccatttcccttg
gggctgccattccctcctccagccccctttcggcctccactgccttcatccccaccgctt
gaaggccccttccctccccagagtggcattccccccacaccaaccgagggatacaatgag
gtagggccgagctatggccctggggagggggctccggagcaggagaaatccaggggtggc
tacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtgagt
gaaatcattggccgagacctgagtggcttccctgcacctcccggagaagagcctcctgcc
tga

DBGET integrated database retrieval system