KEGG   Enhydra lutris kenyoni (northern sea otter): 111141775
Entry
111141775         CDS       T05871                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01524  Platinum drug resistance
elk04014  Ras signaling pathway
elk04064  NF-kappa B signaling pathway
elk04115  p53 signaling pathway
elk04137  Mitophagy - animal
elk04140  Autophagy - animal
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05145  Toxoplasmosis
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05168  Herpes simplex virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111141775
   04630 JAK-STAT signaling pathway
    111141775
   04064 NF-kappa B signaling pathway
    111141775
   04151 PI3K-Akt signaling pathway
    111141775
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111141775
   04137 Mitophagy - animal
    111141775
  09143 Cell growth and death
   04210 Apoptosis
    111141775
   04215 Apoptosis - multiple species
    111141775
   04115 p53 signaling pathway
    111141775
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111141775
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141775
   05202 Transcriptional misregulation in cancer
    111141775
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111141775
   05225 Hepatocellular carcinoma
    111141775
   05220 Chronic myeloid leukemia
    111141775
   05222 Small cell lung cancer
    111141775
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111141775
   05014 Amyotrophic lateral sclerosis
    111141775
   05022 Pathways of neurodegeneration - multiple diseases
    111141775
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111141775
   05170 Human immunodeficiency virus 1 infection
    111141775
   05162 Measles
    111141775
   05168 Herpes simplex virus 1 infection
    111141775
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111141775
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111141775
   01524 Platinum drug resistance
    111141775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111141775
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111141775
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elk02000]
    111141775
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111141775
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111141775
Transporters [BR:elk02000]
 Other transporters
  Pores ion channels [TC:1]
   111141775
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Other DBs
NCBI-GeneID: 111141775
NCBI-ProteinID: XP_022350290
UniProt: A0A2Y9IWG7
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQALVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgcagaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtaaagcaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagcgacctgacatctcagcttcacatcaccccggggacagcgtat
cagagctttgagcaggtggtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggctctgtgcgtggagagcgtagacaaggagatgcag
gcattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacggtaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system