KEGG   Enhydra lutris kenyoni (northern sea otter): 111141900
Entry
111141900         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC111141900
  KO
K08738  cytochrome c
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05134  Legionellosis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05222  Small cell lung cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111141900
   04215 Apoptosis - multiple species
    111141900
   04115 p53 signaling pathway
    111141900
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141900
  09162 Cancer: specific types
   05210 Colorectal cancer
    111141900
   05222 Small cell lung cancer
    111141900
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111141900
   05012 Parkinson disease
    111141900
   05014 Amyotrophic lateral sclerosis
    111141900
   05016 Huntington disease
    111141900
   05017 Spinocerebellar ataxia
    111141900
   05020 Prion disease
    111141900
   05022 Pathways of neurodegeneration - multiple diseases
    111141900
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111141900
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111141900
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111141900
   05134 Legionellosis
    111141900
   05152 Tuberculosis
    111141900
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111141900
   05161 Hepatitis B
    111141900
   05160 Hepatitis C
    111141900
   05164 Influenza A
    111141900
   05162 Measles
    111141900
   05168 Herpes simplex virus 1 infection
    111141900
   05163 Human cytomegalovirus infection
    111141900
   05167 Kaposi sarcoma-associated herpesvirus infection
    111141900
   05169 Epstein-Barr virus infection
    111141900
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111141900
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111141900
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 111141900
NCBI-ProteinID: XP_022350440
UniProt: A0A2Y9IWW7
LinkDB
Position
Unknown
AA seq 217 aa
MAAATNPGVTCQRGEGIWILMRTTVGYLETGRTQGRTGGRRLQGAQSRWMGACARRRVGT
PEPGILAGAVWGSRPQVHLRLKNNGQAWPPGAPGAACEQAPSFHARRKSDLKKGDVEKGK
KIFVQKCAQCHAVEKGGKHKTGPNLHGLFGRKTGQAPGFSFSTRIKNKGITWGEETLMEY
LENPKKHXPRTEMIFTGIKKTGERTDMIAYLKKSTKE
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcagccactaatccaggagtcacctgccaacgtggggagggcatttggattctc
atgagaacaactgtgggctacctggagacaggcaggacacaaggcaggacaggaggaaga
aggctacaaggggcccagagccggtggatgggggcctgtgcaaggcgccgggttgggacc
ccggagcctggcatcctagcaggtgcagtgtgggggtcccggccacaggtgcatctgagg
ctcaagaacaacgggcaggcgtggcctccaggggcgccgggggcggcttgcgagcaggca
ccttcgtttcacgcgcgacgaaagagcgatttaaaaaagggtgatgttgagaagggcaag
aagatttttgttcagaagtgtgcccagtgccatgccgtggaaaagggaggcaagcacaag
actgggccaaatctccatggtttatttggccgaaagacaggccaggcccctggattttct
ttctcaacaagaataaagaataaaggcatcacctggggagaggagacactgatggagtat
ttggagaatcccaagaagcacnatcctcggacagaaatgatcttcactggcattaagaag
acaggggaaagaacagacatgatagcttatctcaaaaaatctactaaggagtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142635
Entry
111142635         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome c, testis-specific-like
  KO
K08738  cytochrome c
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05134  Legionellosis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05222  Small cell lung cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111142635
   04215 Apoptosis - multiple species
    111142635
   04115 p53 signaling pathway
    111142635
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142635
  09162 Cancer: specific types
   05210 Colorectal cancer
    111142635
   05222 Small cell lung cancer
    111142635
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111142635
   05012 Parkinson disease
    111142635
   05014 Amyotrophic lateral sclerosis
    111142635
   05016 Huntington disease
    111142635
   05017 Spinocerebellar ataxia
    111142635
   05020 Prion disease
    111142635
   05022 Pathways of neurodegeneration - multiple diseases
    111142635
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111142635
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111142635
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111142635
   05134 Legionellosis
    111142635
   05152 Tuberculosis
    111142635
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111142635
   05161 Hepatitis B
    111142635
   05160 Hepatitis C
    111142635
   05164 Influenza A
    111142635
   05162 Measles
    111142635
   05168 Herpes simplex virus 1 infection
    111142635
   05163 Human cytomegalovirus infection
    111142635
   05167 Kaposi sarcoma-associated herpesvirus infection
    111142635
   05169 Epstein-Barr virus infection
    111142635
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111142635
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111142635
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111142635
NCBI-ProteinID: XP_022351656
UniProt: A0A2Y9ITK7
LinkDB
Position
Unknown
AA seq 105 aa
MGDAEAGKKIFIQKCAQCHTVEKGGKHKIGPNLWGLFGXKTGQAPGFSYSDANKNKGVIW
GEETLMEYLENPKKYIPGTKMVFAGLKKKSEREDLIQYLKQATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttattcaaaaatgtgctcagtgccacaca
gtggaaaaaggtggaaaacacaagattggtccaaatctctggggcctttttggatgaaaa
acaggacaagcaccaggattttcttattcagatgctaacaaaaacaaaggtgttatctgg
ggagaggaaactctgatggaatatttggagaacccaaagaaatatatccctggaactaaa
atggtctttgctggtcttaaaaagaagagtgagagagaagatcttattcaatatttgaaa
caggcaacatcttcatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147305
Entry
111147305         CDS       T05871                                 

Definition
(RefSeq) cytochrome c isoform X1
  KO
K08738  cytochrome c
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05134  Legionellosis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05222  Small cell lung cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111147305
   04215 Apoptosis - multiple species
    111147305
   04115 p53 signaling pathway
    111147305
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147305
  09162 Cancer: specific types
   05210 Colorectal cancer
    111147305
   05222 Small cell lung cancer
    111147305
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111147305
   05012 Parkinson disease
    111147305
   05014 Amyotrophic lateral sclerosis
    111147305
   05016 Huntington disease
    111147305
   05017 Spinocerebellar ataxia
    111147305
   05020 Prion disease
    111147305
   05022 Pathways of neurodegeneration - multiple diseases
    111147305
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111147305
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111147305
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111147305
   05134 Legionellosis
    111147305
   05152 Tuberculosis
    111147305
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111147305
   05161 Hepatitis B
    111147305
   05160 Hepatitis C
    111147305
   05164 Influenza A
    111147305
   05162 Measles
    111147305
   05168 Herpes simplex virus 1 infection
    111147305
   05163 Human cytomegalovirus infection
    111147305
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147305
   05169 Epstein-Barr virus infection
    111147305
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111147305
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111147305
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111147305
NCBI-ProteinID: XP_022358985
UniProt: A0A2Y9JMA8
LinkDB
Position
Unknown
AA seq 121 aa
MEGKGNKLSVSFLDLKMGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA
PGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATK
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atggagggaaaaggtaataaattgagtgtttcatttttagatttaaaaatgggtgatgtt
gagaagggcaagaagatttttgttcagaagtgtgcccagtgccataccgtggaaaaggga
ggcaagcacaagactgggccaaatctgcatggtttatttggccgaaagacaggtcaggcc
cctggattttcttacaccgatgccaacaagaataaaggcatcacctggggagaggagaca
ctgatggagtatttggagaatcccaagaagtacatccctgggacaaaaatgatcttcgct
ggcattaagaagacaggggaaagagcagacttgatagcttatctcaaaaaagctactaag
gagtaa

DBGET integrated database retrieval system