KEGG   Enhydra lutris kenyoni (northern sea otter): 111141953
Entry
111141953         CDS       T05871                                 

Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111141953
   04015 Rap1 signaling pathway
    111141953
   04072 Phospholipase D signaling pathway
    111141953
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111141953
  09162 Cancer: specific types
   05210 Colorectal cancer
    111141953
   05212 Pancreatic cancer
    111141953
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111141953
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:elk04031]
    111141953
Membrane trafficking [BR:elk04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    111141953
GTP-binding proteins [BR:elk04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    111141953
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N Ser_hydrolase
Other DBs
NCBI-GeneID: 111141953
NCBI-ProteinID: XP_022350548
UniProt: A0A2Y9IPW0
LinkDB
Position
Unknown
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPIEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgcaaacaagagtaagggccagagctccttggcccttcacaaggtgatcatggtc
ggcagtggaggggttggcaagtcagccctgacgcttcagttcatgtatgatgagtttgta
gaagactatgaacccacgaaagctgacagttacaggaagaaagtggttcttgatggagaa
gaagtccagatagatattctggacacggctggacaagaggactacgcagccattcgagat
aactacttccgcagcggggaaggtttcctcctcgtgttctcaatcacagaacacgaatca
tttacagcaaccgccgaattcagggaacagatcctccgcgttaaggctgaagaagataaa
attccattgcttgtcgtgggaaacaagtctgacctagaggagcggaggcaggtgcccatc
gaagaggctaggagtaaagcagaggagtggggcgtgcagtacgtggagacatcagctaaa
acacgggccaatgtggacaaggtgttctttgatctaatgagagaaatcagagccaaaaag
atgtctgagaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaaggtgttgcttactgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157020
Entry
111157020         CDS       T05871                                 

Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk05132  Salmonella infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111157020
   04015 Rap1 signaling pathway
    111157020
   04072 Phospholipase D signaling pathway
    111157020
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157020
  09162 Cancer: specific types
   05210 Colorectal cancer
    111157020
   05212 Pancreatic cancer
    111157020
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111157020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111157020
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:elk04031]
    111157020
Membrane trafficking [BR:elk04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    111157020
GTP-binding proteins [BR:elk04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    111157020
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 111157020
NCBI-ProteinID: XP_022373929
UniProt: A0A2Y9KRM9
LinkDB
Position
Unknown
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKTRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaacaagcccaagggtcagaattctttggccctacacaaagtcatcatggtg
ggcagtggtggtgtgggcaagtctgctctgaccctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctggatggggag
gaagtgcagatcgatatcttggacacagctgggcaggaggactatgctgcaattagagac
aactactttcggagcggggagggtttcctctgtgtcttctctattacagaaatggaatcc
tttgcagccacagccgacttcagggagcagattttaagagtaaaagaagatgagaacgtt
ccatttctgctggttggtaacaaatcagatttagaagataaaaggcaggtttccgtagaa
gaggcaaaaaccagagccgaccagtggaatgtcaactatgtggaaacatctgctaaaact
cgagctaatgttgacaaggtattttttgatctgatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system