KEGG   Enhydra lutris kenyoni (northern sea otter): 111142027
Entry
111142027         CDS       T05871                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04150  mTOR signaling pathway
elk04310  Wnt signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05200  Pathways in cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111142027
   04150 mTOR signaling pathway
    111142027
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    111142027
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142027
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111142027
   05226 Gastric cancer
    111142027
   05224 Breast cancer
    111142027
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111142027
   05022 Pathways of neurodegeneration - multiple diseases
    111142027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111142027
Membrane trafficking [BR:elk04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    111142027
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 111142027
NCBI-ProteinID: XP_022350655
UniProt: A0A2Y9IXH7
LinkDB
Position
Unknown
AA seq 1613 aa
MGAVLRSLLACSFCALLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCSNGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgtgcgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacaattgtagttggaggcttggaggatgcagctgcggtggactttgtattt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtctctggattattgtcccctgatgggctg
gcatgtgattggcttggagaaaaattatactggacagattctgaaacaaatcggattgaa
gtttctaatttagatggttctttacgtaaagtgttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacactgaa
atttactggccaaatggactgactttggattatgaggaacagaagctttattgggcagat
gcaaaactaaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacattatttgaggacacattgtactggact
gactggaatacacactccattttggcttgcaacaagtacactggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcaacca
aatgctacaaatccatgtggaattgataatggtggttgttctcacttgtgtttgatgtct
ccagtcaaacctttttatcagtgtgcttgcccaactggggtcaaacttctggagaatgga
aaaacctgcaaagatggtgccactgaattactgcttttagcacgaaggacagacttgaga
cgcatttctttggatacaccagatttcacagacattgttttgcaattagaagacatccgt
catgccattgccatagattatgatcctgtggaaggctatatatactggaccgatgatgaa
gtgagggccattcgccgctcattcatagatggatccggcagtcagtttgtggtcaccgct
caaattgcacatcctgatggcattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcggatagaagtgacaaggctgaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttccgac
cgagtagtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaatactgat
ggcactgggagaagagtactagtagaagacaaaattcctcacatatttgggtttaccttg
ttgggtgactatgtttactggactgactggcagaggcgtagcatcgaaagagtacacaaa
cgaagtgcagagagggaaatcatcatagaccagcttcctgacctcatgggcctaaaggcc
acaaatgttcatcgaatcattggttccaacccctgtgctgaggaaaatgggggatgtagc
catctttgcctctataggcctcagggcctccgctgtgcctgccccattggctttgaactc
atcagtgacatgaagacctgcatcgtcccagaggctttccttttgttttcacggagagca
gatatcaggcgaatttctttggaaactaacaataataatgtggccattcctcttactggt
gtcaaagaagcttctgctttggattttgatgtaacagacaaccgcatttactggacagat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacacgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacaaatcgaattgaagtgtcaaagctggatgggcagcaccgacag
gttttggtgtggaaagacttagatagccccagagctcttgcattggaccctgctgaagga
tttatgtattggactgaatggggtggaaaacctaagatagaccgagctgccatggatgga
agtgaacgtactacattagttccaaatgtgggccgggcaaatggcctaactattgattat
gctaaaaggaggctttattggacagacttggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacggactggagccgacgcagcattgaacgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcctctcggcaagcagggtggaacgagtgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttggaggttttgtttgtggatgccctgcccactac
tctctcaacgctgacaataggacctgtagtgctccaactactttcctgctcttcagtcaa
aagagtgctatcaaccgcatggtgattgatgagcagcagagccctgacatcatccttcct
atccacagccttcgcaatgtccgggccatagactatgacccactggacaagcagctctat
tggattgactcacgacaaaacatgatccgaaaagcacaagaagatggcagccagggcttt
actgtggttgtgagctcagttccaaatcagaacctagaaatacaaccctatgacctcagc
attgacatttatagccgctacatttactggacttgtgaggccaccaatgtcattaacgta
acaagattagatgggagatcaattggagtggtactaaaaggcgagcaagacagacctcga
gccattgtggtgaacccggagaaggggtatatgtattttaccaatcttcaggaaaggtct
cccaaaattgaacgggctgctttggatggaacagaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgcattagcccttgatagcagattgggcaagctcttttgggcagat
tcagatctccggcgaattgaaagcagtgatctctcaggtgccaaccggatagtattagaa
gactccaatatcttgcagcctgtgggactgactgtgtttgaaaactggctatattggatt
gataagcagcagcaaatgattgaaaaaattgacatgacaggccgagagggtagaaccaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtgaaagagctgaaccttcag
gaatatagacagcacccttgtgctcaggataacggtggctgttcacatatttgtcttgta
aaaggagatggtactacaaggtgctcttgtcccatgcacttggttctgcttcaagatgag
ctatcatgcggagaacctccaacatgttctcctcagcagtttacttgttttacgggagaa
attgactgtatccctgtggcatggcgctgtgatgggtttactgaatgtgaagaccatagt
gatgagctcaactgtcctgtatgctcagaatcccagttccaatgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgttccaacggtcaatgcattgga
aaacataagaaatgtgatcataatgtggattgcagtgacaagtcagatgaattggattgt
tatccaactgaggaaccagctccacaggccaccaacaccgttggttcagttattggagta
attgtcaccatttttgtgtctggaactatatactttatctgccagagaatgttgtgtccg
cgtatgaagggagatggggaaaccatgactaatgactatgtagttcatggaccagcttct
gtgccccttggttatgtgccacatccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctccctaagtatcatggggggcagcagtggacccccttat
gaccgagctcatgtcacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccgccatccccagccacagagcgatcacattacactatg
gaatttggttattcttcgaatagtccttccactcataggtcctacagctacaggccatac
agttaccggcactttgcaccccctaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcccagccggagaatgacctcagtggcaacagccaagggctacactagtgacttg
aactatgactcagagcctgtgcctccacctcccacaccccgaagccaatacctgtcagca
gaagagaactatgaaagctgcccaccttctccatacacagagaggagctactctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111149489
Entry
111149489         CDS       T05871                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04150  mTOR signaling pathway
elk04310  Wnt signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05200  Pathways in cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111149489
   04150 mTOR signaling pathway
    111149489
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    111149489
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111149489
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111149489
   05226 Gastric cancer
    111149489
   05224 Breast cancer
    111149489
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111149489
   05022 Pathways of neurodegeneration - multiple diseases
    111149489
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111149489
Membrane trafficking [BR:elk04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    111149489
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD
Other DBs
NCBI-GeneID: 111149489
NCBI-ProteinID: XP_022362295
UniProt: A0A2Y9JXI4
LinkDB
Position
Unknown
AA seq 2138 aa
MWMLIPPLSPIVSCTHLLLPPPPSFARKPVQGAVTTAPRTAARAPYPGAAGLQWPGGRRT
AGKYPRPGVETWPAAEQSTPAKTAQGSRPSSGPARTAPELTSPEAGPSGRGSSARSREGP
AVPGAAEREPEAGGGVAVPRLRPPRGSLDSVELVAGNGRELRFRTCVRRKWWCSASAAGL
WELGRKSRVLAALQVTHLLPGLDRPRSPPPPRAVKPAPTPRPRLPGEPPREAGARGGPRA
GCGGRPREGAAARGAETRRGFRSRASSLLPRRPGPRRRRRGGGRRREPREEPPPPPPPPR
HGARVGAGRRDNGPAAKCAARGSDFASWGRVGARAAGARRSPRPPPSRGGVTARGPFVSP
SRAPPGKAGPRPAPRAGEERARAAPTPPGAARAGPHLPAARGALRSAAACGRPGEAALGP
WGPRAAGRRRAGTFGAETGLAALRRGLLLEPVSDGRAAGLPAPRTDLSCGESSQIGHRRP
GLLRGPLPSARLSASERTDTCQVPRGPVSPPGPPAPTQHPAVARGRCPRQGGPRGAAARG
DVVAEPGVVERRAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAV
YWTDVSEEAIKQTYLNQTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVADL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWP
NGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRKEILSALYSPMDIQVLSPERQPYFHTRCAEDNGGCSHLCLLSPREP
FYTCACPTGVQLHDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIA
IDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIERANLDGQERHVL
VNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDF
IYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKAVGTNACADGNGGCSHLCF
FTPHAAKCGCPIGLELLSDLKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWVGKNLYWADT
GTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCM
TLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSDMLGQERVVIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLC
LAVPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMVPDDQHSPDLILPLHGLR
NVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSPSQNPDRQPHDLSIDVYSRL
LFWTCEATNTINVHRMNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAA
LDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQP
AGLAVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEISLEEFSAHPC
ARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGA
WRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICL
PNQFRCASGQCVLIKQQCDSFPDCLDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL
FVMGGVYFVCQRVLCQRYAGASGPFPHEYVSGTPHVPLNFIAPGSSQHGPFTGISCGKSM
MSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDMFY
SSNIPTTARPYRPYIIRGMAPPTTPCSTDVCDSDYSANRWKASKYYLDLNSDSDPYPPPP
TPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 6417 nt   +upstreamnt  +downstreamnt
atgtggatgctgattccgcctctcagcccgatcgtgagctgcacacacctcctcctgccc
ccacctccctccttcgctcgcaagccggttcagggagccgtgacaacagctccccggacg
gcggcgcgggccccttacccgggcgcggcaggcctgcagtggccgggtggccgtcggacg
gcggggaagtacccgcggcccggcgtggagacgtggcctgcagcggagcagagcacacca
gccaagactgctcaaggcagccgccccagctcgggccccgcccggaccgccccggaactg
acgtcaccggaggcgggccctagtgggcggggaagctccgcacggagcagggaggggccc
gcggtgccaggagccgccgagagggagccggaagcgggggggggcgtggccgtccccagg
ctccgcccaccgcggggctcgctggactccgtcgagctcgtggccggaaacggtcgggag
ctgcggtttcggacctgcgtgcggcggaaatggtggtgctccgcctcagcagctggcctg
tgggagctcggacgcaaaagccgggtccttgccgctctacaggtgacacacctgcttccg
ggactcgatcggccccggagcccccctcccccgcgggccgtcaagccagctccgaccccg
cgcccccgcctccctggggagccccccagggaggcgggggcgcggggagggccgcgggcc
ggctgcggggggcgcccgcgggagggcgcggcggcgcggggggcggagacgcggcgcggc
ttccgctcccgcgcctcctccctcctcccccgccgtcctggtccgcggcgccggaggagg
ggaggcggcaggcgccgggagccgcgcgaggagccgccgccgccgccgccgccgccgcgc
catggagcccgagtgggcgccggccgcagggacaatggcccggcggccaagtgcgcggcg
cgcggaagcgactttgcaagttgggggcgagttggggcgcgcgccgcgggcgcccgccgt
tccccccgcccgccgccgtcccgggggggggtgaccgcgcgcgggccctttgtctcgccc
tcccgggcccctcccgggaaggctgggccccgtcccgcgccccgggccggcgaggagcgc
gcgcgggcggcgccgaccccgccaggtgcggcgcgggcgggtcctcacctgcccgcggcc
cggggcgcgctccggagtgcggccgcgtgtggccggccgggagaggccgcgctgggaccg
tggggaccccgggccgcgggccggcgcagagcggggactttcggcgcagagacaggcctc
gccgcccttcgtcggggactcctcctcgagcccgtttccgatggccgcgcggccggcctg
ccagccccgagaactgatttaagttgcggagaaagttctcagatcgggcaccggcggcct
ggcctgttgcgcggccccctgccatctgcgaggctgtcggcttccgagcggaccgacacc
tgccaggtgcccagaggacccgtctcgccgcccgggccccccgctcccacccagcacccc
gcggtggcacggggccggtgtccacgccagggggggcctcgtggggccgccgcgcggggt
gacgtggtcgcagagcccggcgtggtcgagaggcgcgctgcctcgcctctcctgctgttc
gccaaccgccgggacgtgcggctggtggacgctggcggagtcaagctggagtccaccatc
gtggtcagcggcctggaggacgcggctgccgtggacttccagttctccaagggagccgtg
tactggacggacgtgagcgaggaggccatcaagcagacctacctgaaccagacgggggtc
gctgtgcagaacgtggtcatctccggcctggtgtcacctgacggcctggcgtgcgactgg
gtcggcaagaagttgtactggacggactcagagaccaaccgcatcgaggtggccgacctc
aacgggacgtcgcgtaaggtcctcttctggcaggacctcgaccagccacgggccatcgcc
ttggaccccgctcacgggtacatgtactggacagactggggcgagacacctcgaatcgag
cgggcaggcatggacggcagtacccggaaaatcatcgtggactccgacatctactggccc
aacgggctgaccatcgacttggaggagcagaagctgtactgggccgacgccaagctcagc
ttcatccaccgtgccaacctggatggctcgttccggcagaaggtcgtggagggcagcctg
acacacccctttgccctgacgctctccggggacactctctactggacggactggcagacc
cgctccatccacgcctgtaacaagaggactggagagaagaggaaggagatccttagtgcc
ctctactcgcccatggacattcaagtgctcagcccggagcggcagccttacttccacacg
cggtgtgcagaggacaacggcggctgctcccacctgtgcttgctgtccccaagggagcct
ttctacacgtgcgcctgccccaccggtgtgcagctccacgacaacggcaagacgtgcaag
gcaggggccgaggaggtgctgctgctggcccggcggacggacctgcggaggatctcgctg
gacacgccagacttcactgacatcgtgctgcaggttgatgatatccgacatgccattgcc
atcgactacgacccgctggagggctatgtctactggacagacgacgaggtgcgggccatc
cgcagggcgtacctggacgggtcaggggcacagacgctggtcaacaccgagatcaacgac
cccgatggcatcgcagtcgactgggtggcccgcaacctctactggacggacacgggcact
gaccgcatcgaggtgacacgtctcaatggcacctcccgcaagatcctggtgtccgaggac
ctggacgagccccgggccattgtgctgcaccctgtgatgggcctcatgtactggacagac
tggggggagaaccccaaaatcgagcgcgccaacctggatgggcaggagcggcacgtcctg
gtgaacacgtccctcgggtggcccaacggcttggccctggacctgcaggagggaaagctg
tactggggagacgccaagacggacaaaatcgaggtgatcaacgttgacgggacaaagagg
cggacactcctggaagacaagctcccccacattttcgggttcacactgctgggggacttc
atctactggaccgactggcagcgtcgcagcatcgagcgcgtgcacaaggtcaaggccagc
cgggacgtcatcatcgaccagctgcccgacctgatggggctgaaggctgtgaacgtggcc
aaggctgtcggaaccaacgcgtgtgcggacgggaacgggggctgcagccacctttgcttc
ttcacgcctcacgccgccaagtgtggctgccccatcggcctggagctgctgagcgacctg
aagacctgcatcgtccctgaagccttcctcgtgttcaccagccgagccgccatccacagg
atctccctggagaccaacaacaacgacgtggccatcccgctgacgggcgtcaaggaggcc
tcggcgctggacttcgacgtatccaacaatcacatatactggacagacgtcagcctgaag
accatcagccgagcattcatgaacgggagctccgtggagcatgtgatcgagttcggcctc
gactacccggaaggcatggctgtcgactgggtggggaagaacctctactgggcggacact
gggaccaacaggatcgaagtggcccggttggacggacagttccggcaggtcctcgtgtgg
agggacctggacaacccgaggtcactggccctggaccccaccaaaggctacatctactgg
actgagtggggggggaaacccaggattgtgcgggccttcatggacgggaccaactgcatg
acgctggtggacaaggtgggtcgggccaacgacctcaccatcgactacgctgaccagcgt
ctctactggaccgacctggacaccaacatgatcgagtcgtccgacatgctgggtcaggag
cgcgttgtgatcgcggacgaccttccgcaccccttcggcctgacgcagtacagcgattac
atctactggaccgactggaacctgcacagcatcgagagggccgacaagaccagcggccgg
aaccgcaccctcatccagggccacctggacttcgtgatggacatcctggtgttccactcc
tcccgccaggatggcctcaacgattgcatgcacaacaacgggcagtgtgggcagctgtgc
ctcgccgtccccggcggccaccgctgtggctgtgcctcacactataccctggaccccagc
agccgcaactgcagcccgcccaccaccttcttgctgttcagccagaaatgtgccatcagc
cgcatggtccccgacgaccagcacagcccagacctcatcctgcccctgcacgggctgagg
aatgtcaaggccatcgactatgaccccctggacaagttcatctactgggtggacggacgc
cagaacatcaagcgagccaaggacgacgggacccagcccttcgttttgacctccccgagc
ccgagccagaacccggacaggcagccccacgacctcagcattgacgtctacagccggttg
ctcttctggacgtgtgaggccaccaacaccatcaacgtccaccggatgaatggagacgcc
atgggtgtggtgctccgtggggaccgcgacaagccgcgggccatcgtcgtcaacgccgag
cgggggtacctgtacttcaccaacatgcaggaccgcgcagccaagatcgagcgagcggcc
ttggacggcaccgagcgtgaggtcctgttcaccacgggcctcatccggcccgtggccctc
gtggtggacaacaggctgggcaagctcttctgggtggacgcggacctgaagcgcatcgaa
agctgtgacctgtcaggggccaaccgcctgaccctggaggacgcgaacatcgtgcagccg
gcgggcctggccgtgctgggcagacacctctactggatcgacaggcagcagcagatgatc
gagcgtgtggagaagaccaccggcgacaagcggacgcgggtccagggccgcgtcgcccac
ctgaccggcatccacgccgtggaagagatcagcctggaggagttctcggctcacccatgt
gcccgggacaatggtggctgctcccacatctgcatcgccaagggtgacgggaccccacgg
tgctcctgcccagtccacctcgtgctcctgcagaacctgctgacctgtggggagcctccc
acctgctcccccgaccagttcgcctgtgccaccggggagattgactgcatcccgggggcc
tggcgctgcgacggcttccccgagtgtgacgaccagagcgacgaggagggctgcccggtg
tgctcagccgcccagttcccctgtgcgcggggccagtgcgtggacctgcgcctgcgatgc
gacggcgaggccgactgccaggaccgctcggacgaggccgactgcgatgccatctgcctg
cccaaccagttccgctgcgccagcggccagtgcgtcctgatcaagcagcagtgcgactcc
ttccccgactgcctcgacggctccgacgagctcatgtgcgagatcaccaagccgccgtcc
gacgacagcccggcccacagcagcgccatcgggccagtcatcggtatcatcctgtccctg
tttgtcatgggcggggtctacttcgtgtgccagcgagtgctgtgtcagcgctacgccgga
gccagtgggcccttcccacatgagtacgtcagtgggaccccccacgttcccctcaatttc
atagcccctggcagctcccagcatggtcccttcacaggcatctcatgtggcaagtccatg
atgagctccgtgagcctgatggggggccgtggtggagtgcccctctatgaccggaaccac
gtcaccggggcctcgtccagcagctcgtccagcaccaaggccactctgtacccaccgatc
ctgaaccctccgccatcccccgccacggacccatccttgtacaacgtggacatgttctac
tcttcaaacattcccaccactgcgagaccctacaggccctacattatccgaggcatggcc
ccccctacgacgccctgcagcacggatgtttgcgacagcgactacagcgccaaccgctgg
aaggccagcaagtactacctggatttgaattcggactcagacccctacccccctccgccc
acgccccacagccagtacctgtcagcggaggacagctgccccccttcgcccgccaccgag
aggagctacttccacctcttccctccccctccgtccccctgcacggactcctcctga

DBGET integrated database retrieval system