KEGG   Enhydra lutris kenyoni (northern sea otter): 111142036
Entry
111142036         CDS       T05871                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05224  Breast cancer
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111142036
   04014 Ras signaling pathway
    111142036
   04015 Rap1 signaling pathway
    111142036
   04066 HIF-1 signaling pathway
    111142036
   04068 FoxO signaling pathway
    111142036
   04151 PI3K-Akt signaling pathway
    111142036
   04152 AMPK signaling pathway
    111142036
   04150 mTOR signaling pathway
    111142036
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111142036
   04115 p53 signaling pathway
    111142036
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111142036
   04550 Signaling pathways regulating pluripotency of stem cells
    111142036
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111142036
   04914 Progesterone-mediated oocyte maturation
    111142036
   04935 Growth hormone synthesis, secretion and action
    111142036
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111142036
  09156 Nervous system
   04730 Long-term depression
    111142036
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111142036
  09149 Aging
   04211 Longevity regulating pathway
    111142036
   04213 Longevity regulating pathway - multiple species
    111142036
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142036
   05202 Transcriptional misregulation in cancer
    111142036
   05205 Proteoglycans in cancer
    111142036
  09162 Cancer: specific types
   05214 Glioma
    111142036
   05218 Melanoma
    111142036
   05215 Prostate cancer
    111142036
   05224 Breast cancer
    111142036
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111142036
   05414 Dilated cardiomyopathy
    111142036
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111142036
   01522 Endocrine resistance
    111142036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111142036
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111142036
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 111142036
NCBI-ProteinID: XP_022350666
UniProt: A0A2Y9IQW8
LinkDB
Position
Unknown
AA seq 183 aa
MGKISSLPNQLFKCCFCDFLKVKLHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYHPPSTTKKTKSQRRRKGGPKKRPGGEQKVGTEASQQMKEERAEKG
DWS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaaaccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagttgcacatcatgtcctcctctcatctcttctacctggccctgtgcttgctc
accttcaccagctccgcgacagctggaccagagacactctgtggggctgaactggtggat
gctcttcagttcgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggt
tcaagcagtcggagggcacctcagacaggcattgtggacgaatgctgcttccggagctgt
gatctgaggaggctagagatgtactgcgcacccctcaagcctgccaagtccgcccgctct
gtccgtgcccagcgccacaccgatatgcccaaggctcagaagtatcatcccccatctacc
accaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaacgcccaggaggg
gaacagaaggtggggacggaagcaagtcagcagatgaaagaagaaagagcagagaaggga
gactggagctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111142293
Entry
111142293         CDS       T05871                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05224  Breast cancer
elk05410  Hypertrophic cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111142293
   04014 Ras signaling pathway
    111142293
   04015 Rap1 signaling pathway
    111142293
   04066 HIF-1 signaling pathway
    111142293
   04068 FoxO signaling pathway
    111142293
   04151 PI3K-Akt signaling pathway
    111142293
   04152 AMPK signaling pathway
    111142293
   04150 mTOR signaling pathway
    111142293
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111142293
   04115 p53 signaling pathway
    111142293
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111142293
   04550 Signaling pathways regulating pluripotency of stem cells
    111142293
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111142293
   04914 Progesterone-mediated oocyte maturation
    111142293
   04935 Growth hormone synthesis, secretion and action
    111142293
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111142293
  09156 Nervous system
   04730 Long-term depression
    111142293
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111142293
  09149 Aging
   04211 Longevity regulating pathway
    111142293
   04213 Longevity regulating pathway - multiple species
    111142293
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142293
   05202 Transcriptional misregulation in cancer
    111142293
   05205 Proteoglycans in cancer
    111142293
  09162 Cancer: specific types
   05214 Glioma
    111142293
   05218 Melanoma
    111142293
   05215 Prostate cancer
    111142293
   05224 Breast cancer
    111142293
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111142293
   05414 Dilated cardiomyopathy
    111142293
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111142293
   01522 Endocrine resistance
    111142293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111142293
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111142293
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 111142293
NCBI-ProteinID: XP_022351061
UniProt: A0A2Y9IRZ2
LinkDB
Position
Unknown
AA seq 207 aa
MESGPIPVFGEAHQDKNWPLSVGAGEGKQLKQHYQFPSHSEENNRAPPRGNHSDFDSVGK
LLDAKPKSWLHPMFPSEETVLVIENRNWFFYSNSWDADKPTGYGSSSRRAPQTGIVDECC
FRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKYHPPSTTKKTKSQRRRKGGPKK
RPGGEQKVGTEASQQMKEERAEKGDWS
NT seq 624 nt   +upstreamnt  +downstreamnt
atggagagcgggcccattccagtatttggggaggcccatcaggacaagaactggcctctg
tctgtgggggctggagaggggaagcagctgaagcaacactatcagtttccttcccattca
gaagagaacaatcgagctcctcccaggggaaaccattcggattttgacagtgtgggcaaa
cttttggatgccaagcccaagtcttggttacaccccatgtttccttcagaggaaactgta
ctagtaattgaaaacagaaattggttcttttattctaattcgtgggatgcagacaagccc
acggggtatggttcaagcagtcggagggcacctcagacaggcattgtggacgaatgctgc
ttccggagctgtgatctgaggaggctagagatgtactgcgcacccctcaagcctgccaag
tccgcccgctctgtccgtgcccagcgccacaccgatatgcccaaggctcagaagtatcat
cccccatctaccaccaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaa
cgcccaggaggggaacagaaggtggggacggaagcaagtcagcagatgaaagaagaaaga
gcagagaagggagactggagctag

DBGET integrated database retrieval system